DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxq2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001098411.1 Gene:foxq2 / 565796 ZFINID:ZDB-GENE-050208-663 Length:244 Species:Danio rerio


Alignment Length:181 Identity:61/181 - (33%)
Similarity:85/181 - (46%) Gaps:27/181 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDT----------TKKSG 305
            |:..:.|..::|.||....:.|..|.|.          .|:||:..:.:.          .|..|
Zfish    29 SAGRAEPEDNVNPSEDLQSTVNEPEQKT----------LSEQDSEKSEEQENDEDHENTHVKSEG 83

  Fly   306 TRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFK 370
            |  .||||.|||.:|..||.:|...||.|.:||.::...|.:|:.....|:|||||||||||||.
Zfish    84 T--DEKPAQSYIALISMAILDSDEKKLLLCDIYQWIMDHYPYFKSKDKNWRNSVRHNLSLNECFI 146

  Fly   371 KLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVK-PYA 420
            |    .|....|||::|.|...:...|.:....|||.|....::..: |||
Zfish   147 K----AGRSDNGKGHFWAIHPANFQDFSNGDYHRRRARRRIRRVTGQLPYA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 39/87 (45%)
foxq2NP_001098411.1 Forkhead 87..171 CDD:278670 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.