DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxj2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_686801.4 Gene:foxj2 / 558490 ZFINID:ZDB-GENE-100922-240 Length:516 Species:Danio rerio


Alignment Length:132 Identity:47/132 - (35%)
Similarity:73/132 - (55%) Gaps:24/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 QQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGW 355
            ::|.|..|  ....|:....||..||..:|..||..:|..||:|::||.::..::.::.....||
Zfish    39 EKDIPLIP--ALSPGSNSKVKPPHSYATLIAMAISSAPEMKLSLNDIYTWISDTFPYYCRAGRGW 101

  Fly   356 KNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTID---ENSAHLFEDEGSLRRRPRGYRSKIKVK 417
            |||:|||||||:||:|:|:..  ..||||:|||:|   |::            :|||.:     :
Zfish   102 KNSIRHNLSLNKCFRKVPRPQ--SDPGKGSYWTMDVPPEST------------QPRGVK-----R 147

  Fly   418 PY 419
            ||
Zfish   148 PY 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 38/90 (42%)
foxj2XP_686801.4 Forkhead 57..134 CDD:278670 36/78 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.