DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxi2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001016544.1 Gene:foxi2 / 549298 XenbaseID:XB-GENE-982122 Length:350 Species:Xenopus tropicalis


Alignment Length:365 Identity:110/365 - (30%)
Similarity:163/365 - (44%) Gaps:88/365 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 QQQPQQLPAQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNYSSSSSSPAKSLNGSESSP--PS 270
            |||.|||| |:....|..||.....:||:     |...|.||..:.:|||  .|||...||  |:
 Frog    13 QQQNQQLP-QRPAAPPALGYGRNEYSSPT-----ASPYPWLNGPAMNSSP--YLNGGSGSPYFPA 69

  Fly   271 QNHLENKVSGSAVVGTGGSSQQDAP-------------STPDTTKKSGTRRPEKPALSYINMIGH 322
                          |.||..:|..|             |.|:   ::...:..:|..||.::|..
 Frog    70 --------------GYGGGQRQFIPPSSGFGVADFPWLSIPN---QADLLKMVRPPYSYSSLIAM 117

  Fly   323 AIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYW 387
            ||:.:|..|||||:||:|:.:::.|::....||:||:|||||||:||||:.:  ....|||||||
 Frog   118 AIQNNPEKKLTLSQIYSYVAENFPFYKKSKAGWQNSIRHNLSLNDCFKKVAR--DDNDPGKGNYW 180

  Fly   388 TIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGY-GDAGMDNGNYYA------SP 445
            |:|.|...:| |.|:.||:.:.....::             :|: |||..|......      ||
 Frog   181 TLDPNCEKMF-DNGNFRRKRKRKSESVE-------------AGFDGDASEDKKELALKSLGSDSP 231

  Fly   446 AFASYDYSAAGATGVS---PAGGQGFADPWNAHAAHSGSSSVGVGMGVGP-------LPQYTN-- 498
            ..||....::..|..|   ||||....|  ::|...:.:|::...|.||.       |..::|  
 Frog   232 RGASALEQSSYGTPESKSRPAGGLAALD--SSHCFTNFASNMNALMNVGAPRHFSARLGDFSNSR 294

  Fly   499 ------ISCLAAGGNVNGSATTPPLAHSALGMAPSASSSS 532
                  .||     .::....:.|...|.:...||..:||
 Frog   295 HYLAELASC-----PISSPQISEPQTGSKVPCYPSKQASS 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 42/87 (48%)
foxi2NP_001016544.1 Forkhead 106..192 CDD:278670 42/88 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.