DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and fd102C

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster


Alignment Length:422 Identity:107/422 - (25%)
Similarity:144/422 - (34%) Gaps:158/422 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 GYMSRISTSPSQVISNAHGMPVLNYSSSSSSPAK-----------SLNGSESSPPSQNHLENKVS 279
            |..||.|..|...:.|.:.:.....|.:.|:...           :||......|...       
  Fly    19 GTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYG------- 76

  Fly   280 GSAVVGTGGSSQQDAP-------------STPDTTKKSG---------TRR---PE--KPALSYI 317
                 |||||. ..||             |.|...:.:.         |:|   ||  ||..|||
  Fly    77 -----GTGGSG-ASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYI 135

  Fly   318 NMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPG 382
            .:|..||..|...||.||:||.|:..:|.:||....||:||:|||||||:||.|    .|....|
  Fly   136 GLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIK----SGRSANG 196

  Fly   383 KGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAF 447
            ||:||.|...:...|. :|..|||    :::.||:.:.|       ....||..|      ||:.
  Fly   197 KGHYWAIHPANMEDFR-KGDFRRR----KAQRKVRKHMG-------LSVDDASTD------SPSP 243

  Fly   448 ASYDY------SAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAAGG 506
            ...|.      |:..|..:|..|     .|::.|.                :.|:.|.|      
  Fly   244 PPLDLTTPPPPSSQSALQLSALG-----YPYHQHY----------------IGQFFNRS------ 281

  Fly   507 NVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSLDNGLRS 571
                         ||.||     :..||...|..:|..                .|.:||..::.
  Fly   282 -------------SAPGM-----THYSPPDPALLMQRQ----------------EANNLDQTIQP 312

  Fly   572 ISLQQLPGLSSIQHAQAQAQAQAHHHHHQHHA 603
            ..|||                  .|.||||.|
  Fly   313 TQLQQ------------------PHSHHQHFA 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 41/87 (47%)
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 41/88 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445458
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.