DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FoxP

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001247011.1 Gene:FoxP / 41182 FlyBaseID:FBgn0262477 Length:520 Species:Drosophila melanogaster


Alignment Length:400 Identity:91/400 - (22%)
Similarity:151/400 - (37%) Gaps:109/400 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 SPTELIDEKPNIGYMELKHYMDATPTATPVSAAQHYSLSALHSMGTPPASSSPIPPYGV------ 127
            ||...|||                   :..:|.||.|...:|..|  ....:|:|..|.      
  Fly    70 SPASSIDE-------------------SSTAAQQHESNPHMHIQG--QHMMAPVPDLGFYNVPEF 113

  Fly   128 ------LMTAHSAGSASPQSNSKTPTDLPQDLQYASSSTSTAK-VQPL-----------QVQLQP 174
                  ||.:    .|.....||.......|..|.....:..| ..||           ::.|:.
  Fly   114 ISEQEKLMFS----DAERFLRSKDNEVCNNDFSYMHDEFAMRKYYHPLFAHGICRWPGCEMDLED 174

  Fly   175 LNHQYASTIKYCS-------NNTILSANDYQLLTSQEQAGQQQPQQLPAQQLQHSPGGGYMSRIS 232
            :    .|.:|:.:       .:|..:....|:::..|...|::..:|.| .:.|.    |:|:..
  Fly   175 I----TSFVKHLNTEHGLDDRSTAQARVQMQVVSQLESHLQKERDRLQA-MMHHL----YLSKQL 230

  Fly   233 TSPSQV-----------------ISNAHGMPVLNYSSSSSSPAKSLNGSE-SSPPSQNHLEN--K 277
            .||:::                 ..|:.|.|:...:|.|......:|.:. .|...:||.:|  .
  Fly   231 LSPTKIDRKDVPGREGKFCRSPLTVNSIGRPIRQTNSPSPLNLPMVNSTNLCSIKKRNHDKNTFS 295

  Fly   278 VSGS---AVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYA 339
            ::|.   .:...|...||:.....:..|.:..|    |..:|.::|..||.:||..:|||:|||.
  Fly   296 INGGLPYMLERAGLDVQQEIHRNREFYKNADVR----PPFTYASLIRQAIIDSPDKQLTLNEIYN 356

  Fly   340 YLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENS----AHLFEDE 400
            :.|.::.:||.....|||::|.||||::||.:.....       |::|.:|:|.    .||    
  Fly   357 WFQNTFCYFRRNAATWKNAIRTNLSLHKCFVRYEDDF-------GSFWMVDDNEFVKRRHL---- 410

  Fly   401 GSLRRRPRGY 410
              .|.|||.|
  Fly   411 --SRGRPRKY 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 32/91 (35%)
FoxPNP_001247011.1 FOXP-CC 157..224 CDD:292777 10/71 (14%)
FH 328..400 CDD:238016 29/82 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445452
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.