DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxi3a

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_944599.2 Gene:foxi3a / 387257 ZFINID:ZDB-GENE-031126-3 Length:353 Species:Danio rerio


Alignment Length:398 Identity:113/398 - (28%)
Similarity:160/398 - (40%) Gaps:88/398 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   211 PQQLPAQQLQHSPG-----------GGYMSRISTSPSQVISNAHGMPVLNYSSSSSSPAKSLNGS 264
            ||.|..|  .||.|           ..|.::...||.|.:.:|:...  .|:..:|:|....||.
Zfish     6 PQSLSPQ--FHSMGQESQEFSLYGDNFYSAQHVPSPQQTLPSAYDFG--EYAGQTSNPYLWFNGP 66

  Fly   265 ESSP-------PSQNHLENKVSGSAVVGTGGS----SQQDAPSTPDTTKKSGTRRPEKPALSYIN 318
            ..||       |....:..:..|::  |.|||    |....||..|..|.      .:|..||..
Zfish    67 GLSPAPCLTTGPQHYGMAKQYVGAS--GIGGSEGAFSWFSLPSQEDLMKL------VRPPYSYSA 123

  Fly   319 MIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGK 383
            :|..||..:|..:||||:||.|:..::.|:......|:||:|||||||:||.|:|:  ....|||
Zfish   124 LIAMAIHGAPNRRLTLSQIYQYVADNFPFYNKSKASWQNSIRHNLSLNDCFMKVPR--DDSDPGK 186

  Fly   384 GNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAFA 448
            |||||:|.|...:| |.|:.||:.:.....:..:           .|.|.:|.|:.  .:||...
Zfish   187 GNYWTLDPNCEKMF-DNGNFRRKRKRKSDSLAEE-----------EGKGYSGSDSA--LSSPKNP 237

  Fly   449 SYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAAGGNVNGS-- 511
            | |.|..|.:.:|    ...|...|:.....|..:.|....:.|.|....:|..::...|.||  
Zfish   238 S-DSSERGNSPIS----TDQAPCLNSFLNQMGDVASGSREALLPSPLAVPLSQRSSPTGVYGSYS 297

  Fly   512 --ATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSLDNGLRSISL 574
              ||.|...    ...|.:|.||:|                 ...|||        |:.|...|.
Zfish   298 PNATMPQWE----TQIPQSSISSTP-----------------YKDGYS--------DSMLNPYSS 333

  Fly   575 QQLPGLSS 582
            |..|.|.|
Zfish   334 QLYPVLGS 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 40/87 (46%)
foxi3aNP_944599.2 FH 116..204 CDD:214627 41/90 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.