DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxl3

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001182057.1 Gene:Foxl3 / 384244 MGIID:3646467 Length:216 Species:Mus musculus


Alignment Length:159 Identity:58/159 - (36%)
Similarity:81/159 - (50%) Gaps:35/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 SSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYI 317
            ||..|....|......|:                 |||.::             :|..:||.|||
Mouse     4 SSQYPYNCFNDDADDYPA-----------------GSSDEE-------------KRLTRPAYSYI 38

  Fly   318 NMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPG 382
            .:|..||::||.|::|||.||.::.:.:.::|.....|:||:|||||||.||.|:|:..|..| |
Mouse    39 ALIAMAIQQSPAGRVTLSGIYDFIMRKFPYYRANQRAWQNSIRHNLSLNSCFVKVPRTEGNDK-G 102

  Fly   383 KGNYWTID---ENSAHLFEDEGSLRRRPR 408
            ||||||..   |:...|||: |:.|||.|
Mouse   103 KGNYWTFAGGCESLLDLFEN-GNFRRRRR 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 43/90 (48%)
Foxl3NP_001182057.1 Forkhead 32..118 CDD:278670 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.