DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxl2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_003750619.1 Gene:Foxl2 / 367152 RGDID:1310041 Length:374 Species:Rattus norvegicus


Alignment Length:419 Identity:126/419 - (30%)
Similarity:169/419 - (40%) Gaps:102/419 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   254 SSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYIN 318
            |....:::..:|:||||.             |.||.:   ||..||..        :||..||:.
  Rat    17 SPESGRAVKEAEASPPSP-------------GKGGGT---APEKPDPA--------QKPPYSYVA 57

  Fly   319 MIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGK 383
            :|..||:||...:||||.||.|:...:.|:.....||:||:||||||||||.|:|:..|..:  |
  Rat    58 LIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGER--K 120

  Fly   384 GNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGH---ANGYYASGYGDAGMDNGNYYASP 445
            |||||:|.....:|| :|:.|||   .|.|...:|...|   ..|.:.||.|             
  Rat   121 GNYWTLDPACEDMFE-KGNYRRR---RRMKRPFRPPPAHFQPGKGLFGSGGG------------- 168

  Fly   446 AFASYDYSAAGATGVSPAGGQGF---ADPWNAHAAHSGSSSVGVGMGVGPLPQYTN----ISCLA 503
                     ||..||..||..|:   |.|....:....:|        .||||..:    .||..
  Rat   169 ---------AGGCGVPGAGADGYGYLAPPKYLQSGFLNNS--------WPLPQPPSPMPYASCQM 216

  Fly   504 AGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSLDNG 568
            |.            |.:|...|.:|:...|| ||||.::....|.||.  ..||...|. :|..|
  Rat   217 AA------------AAAAAAAAAAAAGPGSP-GAAAVVKGLAGPAASY--GPYSRVQSM-ALPPG 265

  Fly   569 LRSISLQQLPGLSSIQHAQAQAQAQAH-HHHHQHHASHPSHSHQGHGSMHQNHGTSSTTPPPSQS 632
            :.: |...|.|..:............| |.||.|.|:.|..:...||         :..|||.|.
  Rat   266 VVN-SYNGLGGPPAAPPPPPPPHPHPHPHAHHLHAAAAPPPAPPHHG---------AAAPPPGQL 320

  Fly   633 GGSHGIDHSPIDRKPAYLPPISPPPMMVA 661
            ..:     ||....|....|.|.|.:..|
  Rat   321 SPA-----SPATAAPPAPAPTSAPGLQFA 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 42/87 (48%)
Foxl2XP_003750619.1 FH 50..138 CDD:214627 43/90 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.