DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FOXD4L4

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_954714.2 Gene:FOXD4L4 / 349334 HGNCID:23762 Length:416 Species:Homo sapiens


Alignment Length:405 Identity:97/405 - (23%)
Similarity:140/405 - (34%) Gaps:150/405 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 QEQAGQQQPQQ--LPAQQL----------QHSPGGGYMSRISTSPSQVISNAHGMPVLNYSSSSS 255
            :|:|.||..:|  .|..|:          :|..|||..|    .||:            :.:...
Human    43 EEEARQQFLEQSLQPGLQVARWGGVALPREHIEGGGGPS----DPSE------------FGTKFR 91

  Fly   256 SPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMI 320
            :|.:|...||.:                                       |:|.||..|||.:|
Human    92 APPRSAAASEDA---------------------------------------RQPAKPPYSYIALI 117

  Fly   321 GHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGN 385
            ..||.::|..:||||.|.|::...:.::|..:..|:||:|||||||:||.|:|:  ..|.|||||
Human   118 TMAILQNPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPR--EPGHPGKGN 180

  Fly   386 YWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDN---GNYYASPA- 446
            ||::|..|..:|::...||||.|..|.::....:..|.   :......|.:.|   |....:|| 
Human   181 YWSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHP---FPLPAAHAALHNPHPGPLLGAPAP 242

  Fly   447 ----FASYDYSAAG----------------------ATGVSPAGGQGFADP-------------- 471
                ..:|..:|.|                      |.....|.|...|.|              
Human   243 PQPVPGAYPNTAPGRRPYALLHPHPLRYLLLSARVYAGAPKKAEGADLATPAPFPCCSPHLVLSL 307

  Fly   472 ------WNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPSASS 530
                  |..|.....|.|.            ..:.|..:|..|.|.....|              
Human   308 GRRARVWRRHREADASLSA------------LRVLCKGSGERVQGLRRVCP-------------- 346

  Fly   531 SSSPLGAAATLQSDY 545
              .|.||.||..||:
Human   347 --RPRGATATCSSDH 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 41/87 (47%)
FOXD4L4NP_954714.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 5/11 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..105 11/89 (12%)
Forkhead 108..194 CDD:278670 41/87 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.