DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and fd19B

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_608369.1 Gene:fd19B / 33010 FlyBaseID:FBgn0031086 Length:260 Species:Drosophila melanogaster


Alignment Length:371 Identity:88/371 - (23%)
Similarity:125/371 - (33%) Gaps:154/371 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALS 315
            ||.|.....|::..|.||.|:::     |||:......||...  |:.....||..    |||.:
  Fly     9 SSFSIRSLLSVDKKEESPISKHN-----SGSSFSSCSSSSSNS--SSDSMAAKSNA----KPAFT 62

  Fly   316 YINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGK 380
            |..:|..||..|...:||||.|..::..::.::|.....|:||:|||||||..|.::|:.:  ..
  Fly    63 YSALIVMAIWSSSEKRLTLSGICKWIADNFPYYRTRKSVWQNSIRHNLSLNPFFVRVPRAL--DD 125

  Fly   381 PGKGNYWTIDENSAHLF--EDEGSLRR----RPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNG 439
            ||:|:||.:|..:..|.  |..|.|||    :..|.|.|:...||  ....||..|:|     ||
  Fly   126 PGRGHYWALDPYAEDLSIGETTGRLRRSNWQQNTGARPKVTGHPY--QRMPYYGHGHG-----NG 183

  Fly   440 NYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAA 504
            .|.                              .||:|:.            |:..:.:      
  Fly   184 PYI------------------------------KAHSAYF------------PIMDHQH------ 200

  Fly   505 GGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGSLDNGL 569
                          |:|:                                               
  Fly   201 --------------HAAM----------------------------------------------- 204

  Fly   570 RSISLQQLPGLSSIQHAQA-----QAQAQAHHHHHQHHASHPSHSH 610
                         :||.||     |.....|||.|||...|| |||
  Fly   205 -------------VQHYQAMMHRYQMMPHPHHHQHQHQHQHP-HSH 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 33/89 (37%)
fd19BNP_608369.1 FH 58..135 CDD:238016 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445456
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.