DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and CG32006

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_726538.1 Gene:CG32006 / 317817 FlyBaseID:FBgn0052006 Length:443 Species:Drosophila melanogaster


Alignment Length:238 Identity:53/238 - (22%)
Similarity:103/238 - (43%) Gaps:44/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LNHQYASTIKYCSNNTILSANDYQLLTSQEQAGQQQPQQLPAQQLQHSPGGGYMSRISTSPSQVI 239
            :::.:.|:.|  .|.|:.|..:..||:.:|:...::.:......|..:....:...|..:|::::
  Fly     1 MSYHFTSSAK--QNVTLQSCKEENLLSLEEEDSDEERELTNLNWLLRNQNLTWPKTIDYNPTEIL 63

  Fly   240 -----------SNAHGMPVLNYSSSSSSPAK------SLNGSES---SPPSQNHLE---NKVSGS 281
                       |..|...:..:.|:..:..|      ..|..:|   .|.:....|   ||:   
  Fly    64 NSKRNTEPTHKSRVHDKQIKMFYSTRENTDKISHIILEANAQKSITKRPTASERFEIFVNKI--- 125

  Fly   282 AVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYE 346
                     ::|.........|..|...|||..:|.::||.|:.::  |::||.::.::::..:.
  Fly   126 ---------KRDLTEYEKLASKYETDVTEKPPFNYSHIIGMAMLQN--GRITLQQLCSWIEAKFA 179

  Fly   347 FFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTI 389
            ||| ....|.||:||||||:.||:...:    .:.|||.||.:
  Fly   180 FFR-VRKKWNNSIRHNLSLHHCFRNRKR----EERGKGGYWEL 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 28/79 (35%)
CG32006NP_726538.1 FH 146..217 CDD:294049 28/77 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.