DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxs1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001012091.1 Gene:Foxs1 / 311547 RGDID:1310679 Length:327 Species:Rattus norvegicus


Alignment Length:391 Identity:117/391 - (29%)
Similarity:150/391 - (38%) Gaps:100/391 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 APSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNS 358
            ||||          .|.||..|||.:|..||:.||..:.|||.||.|:...:.|:|....||:||
  Rat    11 APST----------EPSKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNS 65

  Fly   359 VRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPR--------GYRSKIK 415
            :||||||||||.|:|:  ...|||||:|||:|.:...:|:....||||.|        |.:..:|
  Rat    66 IRHNLSLNECFVKVPR--DDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVK 128

  Fly   416 VKPYAGHANGYYASGYGDAGMDN---GNYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAA 477
                |.|......|  .|.|..|   |.....|..........|..|..||         |....
  Rat   129 ----ADHRPLRATS--PDQGAPNTTTGRLCPFPPEVPNPKGFGGLMGSLPA---------NMCPT 178

  Fly   478 HSGSSSVGVGMGVGPLPQYTNISCLA-AGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATL 541
            .|.:..        .||......|.| :||....|..|.|....|.|.: ||.|.:..||.|.| 
  Rat   179 TSDTRP--------QLPTGPKDMCSAKSGGPRELSEATSPSPCPAFGFS-SAFSEAESLGKAPT- 233

  Fly   542 QSDYAPTASLVAAGYSYATSAGSLDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQHHASHP 606
                 |:.:..:.|.||.....:|     :..:...|||   :|....|.|..       .:|.|
  Rat   234 -----PSVAPESIGSSYQCRMQTL-----NFCMGADPGL---EHLLTSAVATP-------GSSTP 278

  Fly   607 SHSHQGHGSMHQNHGTSSTTPPPSQSGGSHGIDHSPIDRKPAYLPPISPPPMMVALNGGGGYYEG 671
            |.||:              .|.|           .|.|.|..::|...|      :.||.||..|
  Rat   279 SASHR--------------APLP-----------LPADSKEPWVPGGFP------VQGGSGYPLG 312

  Fly   672 L 672
            |
  Rat   313 L 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 44/87 (51%)
Foxs1NP_001012091.1 Forkhead 18..103 CDD:278670 43/86 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.