DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxe3

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_056573.1 Gene:Foxe3 / 30923 MGIID:1353569 Length:288 Species:Mus musculus


Alignment Length:355 Identity:106/355 - (29%)
Similarity:145/355 - (40%) Gaps:97/355 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 GMPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRR 308
            |.|.|...:.|.....:|.|:|   |.:...|       ||| ||.::..|...|...:    ||
Mouse     9 GFPALPSLTPSGPQLPTLAGAE---PGREPEE-------VVG-GGDAEPTAVPGPGKRR----RR 58

  Fly   309 P---EKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFK 370
            |   .||..|||.:|..|:..:|..:|||:.||.::.:.:.|:|.....|:||:||||:||:||.
Mouse    59 PLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFV 123

  Fly   371 KLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVK-------PYAGHANGYYA 428
            |:|:  ..|.||||||||:|..:|.:|::...||||.|..|:::...       |||        
Mouse   124 KVPR--EPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAELPAPPPPPPPFPYA-------- 178

  Fly   429 SGYGDAGMDNGNYYASPAFASYD----YSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMG 489
                       .:...||.||..    :......|:.|       :|                  
Mouse   179 -----------PFPPPPAPASAPPARLFRLDSLLGLQP-------EP------------------ 207

  Fly   490 VGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAA 554
              |.|......|.||     ..|..||.|  |....|..|.:|..||..|.|     |...|:| 
Mouse   208 --PGPVAPEPPCCAA-----PDAAFPPCA--AAASPPLYSPASERLGLPAPL-----PAQPLLA- 257

  Fly   555 GYSYATSAGSLDN-GLRSISLQQ---LPGL 580
               .|.|||:|.. |.....|:|   .|||
Mouse   258 ---LAGSAGALGPLGAGEAYLRQPGFAPGL 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 40/87 (46%)
Foxe3NP_056573.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 19/67 (28%)
FH 64..152 CDD:214627 40/89 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..189 6/44 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.