DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FOXB1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_036314.2 Gene:FOXB1 / 27023 HGNCID:3799 Length:325 Species:Homo sapiens


Alignment Length:328 Identity:88/328 - (26%)
Similarity:140/328 - (42%) Gaps:70/328 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 TRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFK 370
            |...:||..|||::...||:.||...|.|||||.::...:.::|.....|:||:|||||.|:||.
Human     8 TYSDQKPPYSYISLTAMAIQSSPEKMLPLSEIYKFIMDRFPYYRENTQRWQNSLRHNLSFNDCFI 72

  Fly   371 KLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPR---------------------GYRSKI 414
            |:|:  ...:||||::|.:..:...:||:...||||.|                     ..::|:
Human    73 KIPR--RPDQPGKGSFWALHPSCGDMFENGSFLRRRKRFKVLKSDHLAPSKPADAAQYLQQQAKL 135

  Fly   415 KVKPYAGHANGYY-----ASGYGDAGMDNGNYYASPAFASYDYSAAG--ATGVSPAGGQGFADPW 472
            ::...|  |:|.:     |:.|...|:      |.|:...:.::...  |......||..|:...
Human   136 RLSALA--ASGTHLPQMPAAAYNLGGV------AQPSGFKHPFAIENIIAREYKMPGGLAFSAMQ 192

  Fly   473 NAHAAH-------SGSSSVGVGM-----GVGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMA 525
            ...||:       :..||:|.|.     ..|.:...|.|| :|:|..........||.|:|....
Human   193 PVPAAYPLPNQLTTMGSSLGTGWPHVYGSAGMIDSATPIS-MASGDYSAYGVPLKPLCHAAGQTL 256

  Fly   526 PSASSSSSPLGAAA-----------TLQSD----YAPTASLVAAGYSY-ATSAGSLD---NGLRS 571
            |:......|..||.           ||.|:    .:||:|..|...|. ||.:.:|.   :.|.|
Human   257 PAIPVPIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHS 321

  Fly   572 ISL 574
            :::
Human   322 VAV 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 35/87 (40%)
FOXB1NP_036314.2 FH_FOXB2 1..110 CDD:410817 42/103 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 284..325 11/41 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.