DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxa3

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:317 Identity:96/317 - (30%)
Similarity:144/317 - (45%) Gaps:48/317 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   202 SQEQAGQQQPQQLP---AQQLQHSPGGGYMSRISTSPSQVISNAHGMPVLNYSSSSSSP----AK 259
            |.:::|...|::|.   |:...:||         .:|...::..:....||..||...|    |.
  Rat    10 SSQRSGVHLPRRLADVRAESAVYSP---------VNPVPTMAPLNSYMSLNPLSSPYPPGGLQAS 65

  Fly   260 SLNGSESSPPSQN-HLENKVSG-SAVVGTGGS-SQQDAPSTPDTTKK---SGTRRP---EKPALS 315
            .|.....:||:.. .|.....| .|..||||| |...||.......|   .|.|||   .||..|
  Rat    66 PLPTGPLAPPAPTAPLGPTFPGLGAGSGTGGSASGYGAPGPGLVHGKEMAKGYRRPLAHAKPPYS 130

  Fly   316 YINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGK 380
            ||::|..||:::|...|||||||.::...:.::|.....|:||:||:||.|:||.|:.:  ...|
  Rat   131 YISLITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVAR--SPDK 193

  Fly   381 PGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASP 445
            ||||:||.:..:|.::||:...|||:.   |.|::.|...|: :...|:..|..|          
  Rat   194 PGKGSYWALHPSSGNMFENGCYLRRQK---RFKLEEKAKKGN-SATSATRNGTVG---------- 244

  Fly   446 AFASYDYSAAGATGV-SPAGGQGFADPWNAHAAHSGSSSVGVGMGVGP--LPQYTNI 499
              ::...:...||.| |||..|  ..|.:...|.||....|:.....|  .|.:|.:
  Rat   245 --SATSATTTAATAVTSPAQPQ--PTPPSEPEAQSGEDVGGLDCASPPSSAPYFTGL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 37/87 (43%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 43/105 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.