DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxa1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_038967720.1 Gene:Foxa1 / 25098 RGDID:2807 Length:475 Species:Rattus norvegicus


Alignment Length:391 Identity:105/391 - (26%)
Similarity:167/391 - (42%) Gaps:63/391 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 NHQYASTIKYCSN----------NTILSANDYQLLTSQEQAGQQQPQQ-------------LPAQ 217
            |..||.|.:..|:          .::.|.|.|..:.:...:|...|..             |...
  Rat    16 NSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANPGLGAGLSPG 80

  Fly   218 QLQHSPGGGYMSRISTSPSQVISNAHGMPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVS--- 279
            .:...|||...:..|.:.:.|.:....:......|..:.||.|:||......:.|...:.::   
  Rat    81 AVAGMPGGSAGAMNSMTAAGVTAMGAALSPGGMGSMGAQPAASMNGLGPYAAAMNPCMSPMAYAP 145

  Fly   280 ---GSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYL 341
               |.:..|.||.::....|.|..          ||..|||::|..||:::|:..|||||||.::
  Rat   146 SNLGRSRAGGGGDAKTFKRSYPHA----------KPPYSYISLITMAIQQAPSKMLTLSEIYQWI 200

  Fly   342 QKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRR 406
            ...:.::|.....|:||:||:||.|:||.|:.:  ...|||||:|||:..:|.::||:...|||:
  Rat   201 MDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVAR--SPDKPGKGSYWTLHPDSGNMFENGCYLRRQ 263

  Fly   407 PRGYRSKIKVKPYAGHANGYYASGYGDAGM-DNGNYYASPAFASYD-------YSAAGATGVSPA 463
            .   |.|.:.:|.||..:|    |.|..|: :|....:.|...|.:       :..|.....:||
  Rat   264 K---RFKCEKQPGAGGGSG----GGGSKGVPENRKDPSGPVNPSAESPIHRGVHGKASQLEGAPA 321

  Fly   464 GGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPSA 528
            .|.. |.|....  |||:::.|   |...|....:.|...........|:.|| :|.|.|:||..
  Rat   322 PGPA-ASPQTLD--HSGATATG---GASELKSPASSSAPPISSGPGALASVPP-SHPAHGLAPHE 379

  Fly   529 S 529
            |
  Rat   380 S 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 38/87 (44%)
Foxa1XP_038967720.1 Forkhead_N 17..169 CDD:369872 28/151 (19%)
FH_FOXA1 157..268 CDD:410812 46/125 (37%)
HNF_C 394..457 CDD:401339
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.