DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxi2

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:297 Identity:90/297 - (30%)
Similarity:126/297 - (42%) Gaps:62/297 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGG-----------SSQQDAPSTPDTTKKS 304
            :|::.|||....| ....|:.......||||.:..:||           |.||:           
  Rat    67 NSTALSPAPYTPG-PGPAPTYAAAALAVSGSLLSPSGGLAGADLAWLSLSGQQE----------- 119

  Fly   305 GTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECF 369
             ..|..:|..||..:|..||:.:|..:||||:||.|:..::.|::....||:||:|||||||:||
  Rat   120 -LLRLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHNLSLNDCF 183

  Fly   370 KKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLR--RRPRGYRSKIKVKPYAGHANGYYASGYG 432
            ||:|:  ....||||||||:|.|...:| |.|:.|  ||.||..|:..| |.|....   .:...
  Rat   184 KKVPR--DENDPGKGNYWTLDPNCEKMF-DNGNFRRKRRRRGETSEAAV-PGASRPE---RAALE 241

  Fly   433 DAGMDNGNYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGVGPLPQYT 497
            .:|:.:.:...||               ||...:.        ||...|.|..:|...|      
  Rat   242 PSGLVSQDLQTSP---------------SPTAPEA--------AACLSSFSTALGALAG------ 277

  Fly   498 NISCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSP 534
            ..|.|..|...:.|...||...|.....|:.|....|
  Rat   278 GFSTLPDGLPQDFSLRRPPTESSRRPQIPNTSPGFGP 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 42/87 (48%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 42/88 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.