DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FOXJ1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001445.2 Gene:FOXJ1 / 2302 HGNCID:3816 Length:421 Species:Homo sapiens


Alignment Length:425 Identity:99/425 - (23%)
Similarity:140/425 - (32%) Gaps:125/425 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 QAGQQQPQQL-----PAQQLQH-----------SPGGGYMSRISTSPSQVISNAHGMPVLNYSSS 253
            :.|.::|..|     ..|.||.           .|||       |.|       ||...:..|::
Human    20 EGGLEEPDALDDSLTSLQWLQEFSILNAKAPALPPGG-------TDP-------HGYHQVPGSAA 70

  Fly   254 SSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYIN 318
            ..||.    .::.:...|.|...|.:.|.   |..|:.....:.|.......|....||..||..
Human    71 PGSPL----AADPACLGQPHTPGKPTSSC---TSRSAPPGLQAPPPDDVDYATNPHVKPPYSYAT 128

  Fly   319 MIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGK 383
            :|..|::.|...|:|||.||.::..::.:||.....|:||:|||||||:||.|:|:..  .:|||
Human   129 LICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREK--DEPGK 191

  Fly   384 GNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAGMDNGNYYASPAFA 448
            |.:|.||...|         .|...|...|.::.|...|                      ||||
Human   192 GGFWRIDPQYA---------ERLLSGAFKKRRLPPVHIH----------------------PAFA 225

  Fly   449 SYDYSAAGATGVSPAGGQGFADPWNAHAA--------HSGSSSVGVGMGVG--------PLPQYT 497
            .   .||......|..|     |...:..        ...:...|.|.|.|        |||:..
Human   226 R---QAAQEPSAVPRAG-----PLTVNTEAQQLLREFEEATGEAGWGAGEGRLGHKRKQPLPKRV 282

  Fly   498 NISCLAAGGNVNGSATTPPLAHSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSA 562
                        .....||   |.|...|.......||......::.:               .|
Human   283 ------------AKVPRPP---STLLPTPEEQGELEPLKGNFDWEAIF---------------DA 317

  Fly   563 GSLDNGLRSI-SLQQLPGLSSIQHAQAQAQAQAHH 596
            |:|...|.:: :|:..|.||...|..........|
Human   318 GTLGGELGALEALELSPPLSPASHVDVDLTIHGRH 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 37/87 (43%)
FOXJ1NP_001445.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 17/88 (19%)
Forkhead 121..205 CDD:306709 37/94 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..302 12/55 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.