DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and FOXE3

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_036318.1 Gene:FOXE3 / 2301 HGNCID:3808 Length:319 Species:Homo sapiens


Alignment Length:344 Identity:102/344 - (29%)
Similarity:150/344 - (43%) Gaps:72/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   244 GMPVLNYSSSSSSPAKSLNGSESSPPSQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRR 308
            |.|.|...:.|..|...|.|:|   |.:...|      |..|.|.::...||. |...:    ||
Human    15 GFPALPAVAPSGPPPSPLAGAE---PGREPEE------AAAGRGEAAPTPAPG-PGRRR----RR 65

  Fly   309 P---EKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFK 370
            |   .||..|||.:|..|:..:|..:|||:.||.::.:.:.|:|.....|:||:||||:||:||.
Human    66 PLQRGKPPYSYIALIAMALAHAPGRRLTLAAIYRFITERFAFYRDSPRKWQNSIRHNLTLNDCFV 130

  Fly   371 KLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYASGYGDAG 435
            |:|:  ..|.||||||||:|..:|.:|::...||||.|..|:::     ..||            
Human   131 KVPR--EPGNPGKGNYWTLDPAAADMFDNGSFLRRRKRFKRAEL-----PAHA------------ 176

  Fly   436 MDNGNYYASPA------FASYDYSAAGATGVS-----PAGGQGFADPWNAHAAHSGSSSVGV--- 486
                  .|:|.      :|.|    |.|.|.:     |:.|.|.:.|   ....|..|.|.:   
Human   177 ------AAAPGPPLPFPYAPY----APAPGPALLVPPPSAGPGPSPP---ARLFSVDSLVNLQPE 228

  Fly   487 --GMGVGPLPQYTNISCLAAGGNVNGSATTPPLAHSALG---MAPSASSSSSPLGAAATLQSDYA 546
              |:|....|........||......:|.:||| :|.:.   :.|:......|| .|..|.:...
Human   229 LAGLGAPEPPCCAAPDAAAAAFPPCAAAASPPL-YSQVPDRLVLPATRPGPGPL-PAEPLLALAG 291

  Fly   547 PTASL--VAAGYSYATSAG 563
            |.|:|  ::.|.:|....|
Human   292 PAAALGPLSPGEAYLRQPG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 40/87 (46%)
FOXE3NP_036318.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 19/67 (28%)
FH 71..159 CDD:214627 40/89 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.