DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and fkh-10

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:166 Identity:60/166 - (36%)
Similarity:86/166 - (51%) Gaps:18/166 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   295 PSTPDTTKKSGTR-RPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNS 358
            |.:.||:..|.|. :..||..|||.:|..||..||..|:.|:|:|.::...|.:||....||:||
 Worm    25 PLSFDTSIMSPTECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIMNEYPYFRSRGAGWRNS 89

  Fly   359 VRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAG-- 421
            :|||||||:||.|    .|....|||:||.:.......|| .|..|||    |::.||:.:.|  
 Worm    90 IRHNLSLNDCFVK----AGRAANGKGHYWAVHPACVKDFE-RGDFRRR----RAQRKVRRHMGLQ 145

  Fly   422 HANGYYASGYGDAGMDNGNYYASPAF--ASYDYSAA 455
            ..:|..:...|..|.|.    :.|.|  |.::::.|
 Worm   146 VEDGDSSDEEGSPGSDP----SPPIFPTALWNFNCA 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 38/87 (44%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 37/87 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.