DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxf1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_034556.2 Gene:Foxf1 / 15227 MGIID:1347470 Length:378 Species:Mus musculus


Alignment Length:402 Identity:140/402 - (34%)
Similarity:174/402 - (43%) Gaps:104/402 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 GTGGSSQQDAPSTPDTTKK--SGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEF 347
            |.||.:...|.:.|...||  :|.||||||..|||.:|..||:.||:.:|||||||.:||..:.|
Mouse    20 GAGGQAMDPAAAGPTKAKKTNAGVRRPEKPPYSYIALIVMAIQSSPSKRLTLSEIYQFLQARFPF 84

  Fly   348 FRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRS 412
            |||.|.||||||||||||||||.|||||:  |:||||:|||||..|..:|| |||.||||||:|.
Mouse    85 FRGAYQGWKNSVRHNLSLNECFIKLPKGL--GRPGKGHYWTIDPASEFMFE-EGSFRRRPRGFRR 146

  Fly   413 KIK-VKPYAGHAN-----------GYYASG-----------YGDAGMDNGNYYAS---------- 444
            |.: :||.....|           |:..||           .|..||.||:...:          
Mouse   147 KCQALKPVYSMVNGLGFNHLPDTYGFQGSGGLSCAPNSLALEGGLGMMNGHLAGNVDGMALPSHS 211

  Fly   445 ----PAFASYDY------SAAG----------ATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMG 489
                |:...:.|      ||||          |:.:.|||..|..:|   ||.:|.|        
Mouse   212 VPHLPSNGGHSYMGGCGGSAAGEYPHHDSSVPASPLLPAGAGGVMEP---HAVYSSS-------- 265

  Fly   490 VGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPS--ASSSSSPLGAAATLQSDYAPTASLV 552
                                 :|..||.|.:||....|  .....||...||...|....|.|| 
Mouse   266 ---------------------AAAWPPAASAALNSGASYIKQQPLSPCNPAANPLSGSISTHSL- 308

  Fly   553 AAGYSYATSAGSLDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHHHQHHASHPSHSH-QGHGSM 616
            ...|.:..|    .||  ...||.:|.    .|:|:.:...........:|...|..| .|.||.
Mouse   309 EQPYLHQNS----HNG--PAELQGIPR----YHSQSPSMCDRKEFVFSFNAMASSSMHTTGGGSY 363

  Fly   617 HQNHGTSSTTPP 628
            :....|.....|
Mouse   364 YHQQVTYQDIKP 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 57/87 (66%)
Foxf1NP_034556.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..45 8/24 (33%)
Forkhead 48..133 CDD:306709 56/86 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 182 1.000 Inparanoid score I3958
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm44221
orthoMCL 1 0.900 - - OOG6_108542
Panther 1 1.100 - - O PTHR46262
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5614
SonicParanoid 1 1.000 - - X1971
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.890

Return to query results.
Submit another query.