DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxl1

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_032050.2 Gene:Foxl1 / 14241 MGIID:1347469 Length:336 Species:Mus musculus


Alignment Length:271 Identity:91/271 - (33%)
Similarity:129/271 - (47%) Gaps:41/271 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   309 PEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLP 373
            |:||..|||.:|..||:::|..::||:.||.::...:.|:.....||:||:||||||||||.|:|
Mouse    47 PQKPPYSYIALIAMAIQDAPEQRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNECFVKVP 111

  Fly   374 KGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANG---YYASGYGDAG 435
            :..  |:||||:|||:|.....:||: |:.|||.|      |.||.||....   .......:.|
Mouse   112 REK--GRPGKGSYWTLDPRCLDMFEN-GNYRRRKR------KPKPAAGSPEAKRTRVEPPESEVG 167

  Fly   436 MDNGNYYASPAFASY------DYSAAGATGVS-----PAGGQGFADPWNAHAAHSGSSSVGVGMG 489
            .|.|    ||..|:.      |.|.:.|.|.:     |..|....|| :|.....|:.:|..|..
Mouse   168 CDVG----SPDLATALPTRAPDRSQSPAVGTARPALLPWPGPEPRDP-DADLTVQGAGAVASGQL 227

  Fly   490 VGPLPQYTNISCLAAGGNVNGSATTPPLAHSALGMAPS-ASSSSSP---------LGAA-ATLQS 543
            ..|.....:..|.|..|:..||.:......|.|.:.|: ||.:.:|         ||:: ....|
Mouse   228 QRPAHHLGSPLCPAPSGSPKGSKSKSFSIDSILAVRPTPASGAEAPGIPKPVPGALGSSLLAASS 292

  Fly   544 DYAP--TASLV 552
            ..||  .||||
Mouse   293 GLAPPFNASLV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 40/87 (46%)
Foxl1NP_032050.2 FH 49..137 CDD:214627 41/90 (46%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 140..214 23/84 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 227..252 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.