DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and Foxd4

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:359 Identity:106/359 - (29%)
Similarity:141/359 - (39%) Gaps:106/359 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 APSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNS 358
            ||.||.||...|. :|.||..|||.:|..||.:||..:||||.|.|::...:.::|..:..|:||
Mouse    87 APRTPATTTADGP-QPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNS 150

  Fly   359 VRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHA 423
            :|||||||:||.|:|:  ..|.|||||||::|..|..:|::...||||.|..|..   .|..||.
Mouse   151 IRHNLSLNDCFVKIPR--EPGHPGKGNYWSLDPASQDMFDNGSFLRRRKRFKRHH---PPSGGHP 210

  Fly   424 NGYYASGYGDAGM--------------DNGNYYASPAF--------------ASYDYSAAGATGV 460
            :..:......|.:              ...|..|.||.              ..|...||.|.|.
Mouse   211 HCPFPPPAVPATLHVSQPSLLLRYSAPPQPNLAAHPAAPPRSHPCAPLHPHPMRYLLLAAPAYGD 275

  Fly   461 SPAGGQGFAD-----------------PWNAHAAHSGSSSVGVGMGVGPLPQYTNISCLAAGGNV 508
            :|...:| ||                 ||....: ||:.|   |.|.......:.:..:..||  
Mouse   276 NPRKAEG-ADPATPLAIPALQPVLGSQPWERDQS-SGTRS---GRGCASFTIESIMQGVTGGG-- 333

  Fly   509 NGSATTPPLA---------HSALGMAPSASSSSSPLGAAATLQSDYAPTASLVAAGYSYATSAGS 564
            .|||.:|..|         |....:.|.|   :|||                      :..||||
Mouse   334 TGSAQSPSFAPWSYCHLLQHPPCLLHPQA---ASPL----------------------FHMSAGS 373

  Fly   565 LDNGLRSISLQQLPGLSSIQHAQAQAQAQAHHHH 598
                 |:|    ||     |..|.....|...||
Mouse   374 -----RTI----LP-----QQPQPPLPLQQEQHH 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 42/87 (48%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Forkhead 103..189 CDD:278670 42/87 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.