Sequence 1: | NP_523950.2 | Gene: | bin / 38766 | FlyBaseID: | FBgn0045759 | Length: | 676 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001304690.1 | Gene: | foxl2b / 100149117 | ZFINID: | ZDB-GENE-170803-1 | Length: | 285 | Species: | Danio rerio |
Alignment Length: | 260 | Identity: | 85/260 - (32%) |
---|---|---|---|
Similarity: | 115/260 - (44%) | Gaps: | 60/260 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 270 SQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTL 334
Fly 335 SEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFED 399
Fly 400 EGSLRRRPRGYRSKIKVKPYAGH------------------ANGYYASG---------------- 430
Fly 431 -YGDAGMDNGNYYASPAFA--SYD-YSAAGATG----VSPAGGQGF----------ADPWNAHAA 477
Fly 478 477 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
bin | NP_523950.2 | Forkhead | 311..399 | CDD:278670 | 42/87 (48%) |
foxl2b | NP_001304690.1 | FH | 42..130 | CDD:214627 | 43/90 (48%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |