DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxl2b

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:260 Identity:85/260 - (32%)
Similarity:115/260 - (44%) Gaps:60/260 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 SQNHLENKVSGSAVVGTGGSSQQDAPSTPDTTKKSGTRRPEKPALSYINMIGHAIKESPTGKLTL 334
            |.:.|::......|..|....::|.|.....::|  |...:||..||:.:|..||:||...:|||
Zfish     3 SYHSLDDDAMALMVHDTNAVKKEDEPLQEPGSEK--TDPAQKPPYSYVALIAMAIRESTEKRLTL 65

  Fly   335 SEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLNECFKKLPKGMGVGKPGKGNYWTIDENSAHLFED 399
            |.||.|:...:.|:.....||:||:||||||||||.|:|:..|..:  ||||||:|.....:|| 
Zfish    66 SGIYQYIITKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGER--KGNYWTLDPACEDMFE- 127

  Fly   400 EGSLRRRPRGYRSKIKVKPYAGH------------------ANGYYASG---------------- 430
            :|:.|||   .|.|...:|.|.|                  |..|..||                
Zfish   128 KGNYRRR---RRMKRPFRPPAAHFQAGKSLFGGDAYTGYLPAPKYLQSGFMNSSWPLPQPPPPAM 189

  Fly   431 -YGDAGMDNGNYYASPAFA--SYD-YSAAGATG----VSPAGGQGF----------ADPWNAHAA 477
             |....|.|||..|..|.:  ||: ||...|.|    ::..||.|.          |.|.|:.||
Zfish   190 SYASCQMPNGNMGAMKALSTPSYNPYSRMQAMGLPNMMNSYGGMGHHQQPQHQQQSAAPSNSAAA 254

  Fly   478  477
            Zfish   255  254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 42/87 (48%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 43/90 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.