DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin and foxl3

DIOPT Version :9

Sequence 1:NP_523950.2 Gene:bin / 38766 FlyBaseID:FBgn0045759 Length:676 Species:Drosophila melanogaster
Sequence 2:NP_001182055.1 Gene:foxl3 / 100003253 ZFINID:ZDB-GENE-121214-362 Length:220 Species:Danio rerio


Alignment Length:205 Identity:67/205 - (32%)
Similarity:94/205 - (45%) Gaps:43/205 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 GTRRPEK---PALSYINMIGHAIKESPTGKLTLSEIYAYLQKSYEFFRGPYVGWKNSVRHNLSLN 366
            ||...:|   ||.|||.:|..||::||..|:|||.||.::.|.:.::|.....|:||:|||||||
Zfish    24 GTDEEKKVCRPAYSYIALIAMAIQQSPENKVTLSGIYEFIMKRFPYYRSNQRAWQNSIRHNLSLN 88

  Fly   367 ECFKKLPKGMGVGKPGKGNYWTID---ENSAHLFEDEGSLRRRPRGYRSKIKVKPYAGHANGYYA 428
            .||.|:|:..| .:.|||||||..   |:...|||: |:.|||.|....|:.:|.          
Zfish    89 SCFIKVPRTEG-NEKGKGNYWTFATGCESMLDLFEN-GNFRRRRRRRNLKMGLKE---------- 141

  Fly   429 SGYGDAGMDNGNYYASPAFASYDYSAAGATGVSPAGGQGFADPWNAHAAHSGSSSVGVGMGV--- 490
                          .:.||.|.|  |..|..|..:....|.:  .:|.|........:...:   
Zfish   142 --------------PTEAFISMD--AHQAVAVRSSDSDSFMN--TSHRAAQNKPETEIKFSIDYI 188

  Fly   491 ----GPLPQY 496
                .|||.:
Zfish   189 LSTPDPLPAF 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
binNP_523950.2 Forkhead 311..399 CDD:278670 44/93 (47%)
foxl3NP_001182055.1 Forkhead 33..119 CDD:278670 41/86 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.