DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and ARFA1D

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001323060.1 Gene:ARFA1D / 843385 AraportID:AT1G70490 Length:181 Species:Arabidopsis thaliana


Alignment Length:168 Identity:42/168 - (25%)
Similarity:68/168 - (40%) Gaps:46/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 TRVKTTGI-IETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEM 241
            |.:.|.|. :|| ...|.:.|.::|||||...|..|.|.|:....:||.|..:..|.|:...:|:
plant    44 TTIPTIGFNVET-VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDEL 107

  Fly   242 NRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRM 306
            :||:...:|.|::          :::|.||:||                   .|....|....::
plant   108 HRMLNEDELRDAV----------LLVFANKQDL-------------------PNAMNAAEITDKL 143

  Fly   307 KFENLNKRKDQKEIYTHLTCATD-----------TNNV 333
            ...:|.    |:..|...||||.           :||:
plant   144 GLHSLR----QRHWYIQSTCATSGEGLYEGLDWLSNNI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 42/168 (25%)
G-alpha 35..349 CDD:206639 42/168 (25%)
ARFA1DNP_001323060.1 PLN00223 1..181 CDD:165788 42/168 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.