DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and XLG2

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_195165.2 Gene:XLG2 / 829589 AraportID:AT4G34390 Length:861 Species:Arabidopsis thaliana


Alignment Length:399 Identity:88/399 - (22%)
Similarity:171/399 - (42%) Gaps:94/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFA-DP 99
            ||||:|:.:.|.:||.||.:.:::..:|.|:.|..:.::.:|....|.:::.|..|.:.|.: |.
plant   464 KLLLIGSEKGGATTIYKQARSLYNVSFSLEDRERIKFIIQTNLYTYLAMVLEAHERFEKEMSNDQ 528

  Fly   100 SRTDIARQFFTHASAADEGILLPEI------VLLMKK--------------------LWADGGVQ 138
            |..::..:    .||.....:.|.:      ||..|:                    ||....:|
plant   529 SSGNVGDE----TSAKPGNSINPRLKHFSDWVLKEKEDGNLKIFPPSSRENAQTVADLWRVPAIQ 589

  Fly   139 QSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTT--GIIETHFSC--------- 192
            .::.|.|: .|..:|.|:|..:..|::..|.|:..|:|:....::  |:....||.         
plant   590 ATYKRLRD-TLPRNAVYFLERILEISRSEYDPSDMDILQAEGLSSMEGLSCVDFSFPSTSQEESL 653

  Fly   193 -------KQLHFKLFDVGGQRSERKKW--IHCFEGVTAIIFCVALSGYDLVLAEDEE------MN 242
                   ..:.::|..: ..||..:.|  :..||....:||||:|:.|    ||:.|      :|
plant   654 ESDYQHDTDMKYQLIRL-NPRSLGENWKLLEMFEDADLVIFCVSLTDY----AENIEDGEGNIVN 713

  Fly   243 RMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTIC--FPEYT-----------GT 294
            :|:.:.:||:::...........:|.|.|.||.||||:..||..|  |.::.           ..
plant   714 KMLATKQLFENMVTHPSLANKRFLLVLTKFDLLEEKIEEVPLRTCEWFEDFNPLISQNQTSRHNP 778

  Fly   295 NTFEEAANYIRMKFE----------NLNKRKDQKEIYT-HLTCATDT--NNVKFVFDAVTDVIIK 346
            ...:.|.:||..||:          |:..|..:.:::. .::..:||  |.:::..:     |:|
plant   779 PMAQRAFHYIGYKFKRLYDSILEPVNMRGRSFKPKLFVCQVSLESDTVDNALRYARE-----ILK 838

  Fly   347 NNLKQIGLF 355
            .::::..:|
plant   839 WHVEETSMF 847

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 87/395 (22%)
G-alpha 35..349 CDD:206639 87/391 (22%)
XLG2NP_195165.2 G-alpha 464..840 CDD:206639 87/390 (22%)
G-alpha 464..837 CDD:278904 85/387 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10218
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.