DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and gnaq

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001037982.1 Gene:gnaq / 733773 XenbaseID:XB-GENE-973433 Length:359 Species:Xenopus tropicalis


Alignment Length:367 Identity:178/367 - (48%)
Similarity:227/367 - (61%) Gaps:28/367 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQE 65
            |.|.:| ...|||...:..|:|.||.:...|..|:||||||.|||||||.:|||:|||.:|||.|
 Frog     7 MACCLS-EEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDE 70

  Fly    66 ECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHASAADEGILLPEI------ 124
            :...:.::|:.|...::..:||||..|||.:.           :.|...  ..:|:.|:      
 Frog    71 DKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYK-----------YEHNKG--HALLIREVDVEKVA 122

  Fly   125 ------VLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTT 183
                  |..:|.||.|.|:|:::.|.|||||:||..||||.|||||...|:|:||||||.||.||
 Frog   123 SFENPYVDAIKYLWNDPGIQEAYDRRREYQLSDSTKYYLNDLDRIASQGYLPSQQDVLRVRVPTT 187

  Fly   184 GIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESL 248
            ||||..|..:.:.|::.|||||||||:|||||||.||:|:|.||||.||.||.|.:..|||.||.
 Frog   188 GIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESK 252

  Fly   249 KLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAA-NYIRMKFENLN 312
            .||.:|....||..:|:|||||||||.||||..|.|...||||.|.....:|| .:|...|.:||
 Frog   253 ALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQRDAQAAREFILKMFVDLN 317

  Fly   313 KRKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGL 354
            ...| |.||:|.||||||.|::|||.||.|.|::.|||:..|
 Frog   318 PDSD-KIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 171/351 (49%)
G-alpha 35..349 CDD:206639 162/326 (50%)
gnaqNP_001037982.1 G-alpha 40..353 CDD:206639 162/326 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.