DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and gnao1

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001016995.1 Gene:gnao1 / 549749 XenbaseID:XB-GENE-921635 Length:354 Species:Xenopus tropicalis


Alignment Length:356 Identity:235/356 - (66%)
Similarity:283/356 - (79%) Gaps:3/356 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAVSTARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQE 65
            |||.:| |.::.|:||||.|::.|:.:|..||.:||||||||||||||||||||||||:.|:|.|
 Frog     1 MGCTLS-AEERAALERSKQIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGE 64

  Fly    66 ECEEYRRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIARQFFTHAS-AADEGILLPEIVLLMK 129
            :.::|:.||:|||:|||..|:|||..|.||:.|..|...|:......| ..|.....||::..|.
 Frog    65 DVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERRADAKMVCDVVSRMEDTEPFSPELLSAMM 129

  Fly   130 KLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQ 194
            :||||.|:|:.|.|||||||||||.|||:|||||...:|.||:||:||||||||||:||||:.|.
 Frog   130 RLWADSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKN 194

  Fly   195 LHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDSICNSKW 259
            |||:|||||||||||||||||||.||||||||||||||.||.|||..|||.|||.|||||||:|:
 Frog   195 LHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKF 259

  Fly   260 FVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEIYTHL 324
            |::|||||||||||||.||||:||||||||||||.||:|:||.||:.:||:.| |...||||.|:
 Frog   260 FIDTSIILFLNKKDLFAEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKN-RSPNKEIYCHM 323

  Fly   325 TCATDTNNVKFVFDAVTDVIIKNNLKQIGLF 355
            ||||||||::.|||||||:||.|||:..||:
 Frog   324 TCATDTNNIQVVFDAVTDIIIANNLRGCGLY 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 227/339 (67%)
G-alpha 35..349 CDD:206639 216/314 (69%)
gnao1NP_001016995.1 G-alpha 34..348 CDD:206639 216/314 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D406662at33208
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.