DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and gnal

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001007340.1 Gene:gnal / 492467 ZFINID:ZDB-GENE-041114-26 Length:379 Species:Danio rerio


Alignment Length:394 Identity:153/394 - (38%)
Similarity:213/394 - (54%) Gaps:56/394 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAVSTARDKEAI------ERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHD 59
            |||..::..:.:.|      |.:|.|::.|:.|.:...:..:||||||||||||||||||:|:|.
Zfish     1 MGCLGNSKTEDQRIDEKAQREANKKIEKQLQKERQAYKATHRLLLLGAGESGKSTIVKQMRILHV 65

  Fly    60 TGYSQEECEEYRRVVFSNTVQSLMVIIRAMGRL--KIEFADPSRT---------------DIARQ 107
            .|::.||.::....:..|...:::.||.||..|  .:..|:||..               |...:
Zfish    66 NGFNAEEKKQKILDIRKNVKDAIVTIISAMSTLTPPVSIANPSNQPRAEYIKSIAPLSDFDYTEE 130

  Fly   108 FFTHASAADEGILLPEIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQ 172
            ||.||                |.||.|.||:..|.||.||||.|.|.|:|..::.:.|.:|.||.
Zfish   131 FFEHA----------------KHLWDDEGVKACFERSNEYQLIDCAQYFLERIESVRQNDYTPTD 179

  Fly   173 QDVLRTRVKTTGIIETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAE 237
            ||:||.||.|:||.||.|...:::|.:|||||||.||:|||.||..||||||..|.|.|::|:.|
Zfish   180 QDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVAASSSYNMVIRE 244

  Fly   238 DEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKI--KRSPLTICFPEYTGTNTFEEA 300
            |...||:.|||.||.||..:::....|:||||||:|:..|||  .:|.|...||||.......||
Zfish   245 DNSTNRLRESLDLFRSIWTNRFLRTISVILFLNKQDMLAEKILAGKSKLEDYFPEYARYTLPPEA 309

  Fly   301 AN-------------YIRMKFENLNKRK--DQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLK 350
            ..             :||.:|..::...  |:...|.|.|||.||.|::.||:...|:|.:.:|:
Zfish   310 TPDPGEDPKVSRAKFFIRDEFLKISTASGTDKHYCYPHFTCAVDTENIRHVFNDCRDIIQRMHLR 374

  Fly   351 QIGL 354
            |..|
Zfish   375 QYEL 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 149/378 (39%)
G-alpha 35..349 CDD:206639 141/347 (41%)
gnalNP_001007340.1 G_alpha 20..376 CDD:214595 147/371 (40%)
G-alpha 41..373 CDD:206639 141/347 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.