DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and gna11

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_989150.1 Gene:gna11 / 394755 XenbaseID:XB-GENE-944497 Length:359 Species:Xenopus tropicalis


Alignment Length:364 Identity:174/364 - (47%)
Similarity:232/364 - (63%) Gaps:22/364 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGCAVSTARDKEAIERSK----NIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTG 61
            |.|.:|     |.::.||    .|::.||.:.:.:..|:||||||.|||||||.:|||:|||.:|
 Frog     7 MACCLS-----EEVKESKRINAEIEKQLRRDKKDSRRELKLLLLGTGESGKSTFIKQMRIIHGSG 66

  Fly    62 YSQEECEEYRRVVFSNTVQSLMVIIRAMGRLKIEF---ADPSRTDIARQFFTHASAADEGILLPE 123
            ||:|:...:.::||.|...::..:||||..|||.:   .:.:...:.|:.........|    ..
 Frog    67 YSEEDKRGFTKLVFQNIFTAMQSMIRAMDTLKIPYKCEQNKANAQVVREVDVEKVCTFE----QP 127

  Fly   124 IVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIET 188
            .|..:|.||:|.|:|:.:.|.|||||:|||.|||..:|||::|.|:||||||||.||.||||||.
 Frog   128 YVNAIKNLWSDPGIQECYDRRREYQLSDSAKYYLTDVDRISKPGYLPTQQDVLRVRVPTTGIIEY 192

  Fly   189 HFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLFDS 253
            .|..:.:.|::.|||||||||:|||||||.||:|:|.||||.||.||.|.:..|||.||..||.:
 Frog   193 PFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRT 257

  Fly   254 ICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAA---NYIRMKFENLNKRK 315
            |....||..:|:|||||||||.|:||..|.|...|||:.|..  .:||   .:|...|.:||...
 Frog   258 IITYPWFQNSSVILFLNKKDLLEDKIMYSHLVDYFPEFDGPQ--RDAATAREFILKMFVDLNPDS 320

  Fly   316 DQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGL 354
            | |.||:|.||||||.|::|||.||.|.|:::|||:..|
 Frog   321 D-KIIYSHFTCATDTENIRFVFAAVKDTILQHNLKEYNL 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 169/348 (49%)
G-alpha 35..349 CDD:206639 160/319 (50%)
gna11NP_989150.1 G-alpha 40..353 CDD:206639 160/319 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.