DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and cta

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001036421.1 Gene:cta / 3355131 FlyBaseID:FBgn0000384 Length:457 Species:Drosophila melanogaster


Alignment Length:366 Identity:137/366 - (37%)
Similarity:206/366 - (56%) Gaps:30/366 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 STARDKEAIERSKNIDRALRAEGERAASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEY 70
            ||..:.|...:||.||:.|..|......:|||||||||||||||.:|||:|||...:..|...||
  Fly   104 STPEELEQRYKSKEIDKFLEKEKHTFRRQVKLLLLGAGESGKSTFLKQMRIIHGVNFDYELLLEY 168

  Fly    71 RRVVFSNTVQSLMVIIRAMGRLKIEFADPSRTDIA-------------RQFFTHASAADEGILLP 122
            :.|::.|.::.:.|::.|..:|.|.:....|...|             .:|..:|         |
  Fly   169 QSVIYQNVIRGMQVLLDAREKLNIAWGSDGREQDAYDAKLMECNSLDVPKFMEYA---------P 224

  Fly   123 EIVLLMKKLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIE 187
            .|    .:||.|.|::::|.|.||:|::||..|:|:.:.|:|.|:|:||.:|:|..|..|.|:.|
  Fly   225 PI----SRLWQDRGIRRAFERRREFQISDSVSYFLDEIQRLATPDYVPTHKDILHCRKATKGVYE 285

  Fly   188 THFSCKQLHFKLFDVGGQRSERKKWIHCFE-GVTAIIFCVALSGYDLVLAEDEEMNRMIESLKLF 251
            .....:.:.|...||||||::|:||..||: .||:|||.|:.|.:|.|||||.:.||:.||..:|
  Fly   286 FCVKVQNIPFVFVDVGGQRTQRQKWTRCFDSSVTSIIFLVSSSEFDQVLAEDRKTNRLEESKNIF 350

  Fly   252 DSICNSKWFVETSIILFLNKKDLFEEKI--KRSPLTICFPEYTGT-NTFEEAANYIRMKFENLNK 313
            |:|.|:..|...||||||||.||.|:|:  ..:.:...:|.:.|. ::..:..|:|...|.::.:
  Fly   351 DTIVNNATFKGISIILFLNKTDLLEQKVCNPETDIRWYYPHFNGNPHSVLDVQNFILQMFMSVRR 415

  Fly   314 RKDQKEIYTHLTCATDTNNVKFVFDAVTDVIIKNNLKQIGL 354
            ......||.|.|.|.||.|:..||::|.|.|::.||..:.|
  Fly   416 SSSISRIYHHFTTAIDTRNINVVFNSVKDTILQRNLNALML 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 133/355 (37%)
G-alpha 35..349 CDD:206639 125/330 (38%)
ctaNP_001036421.1 G_alpha 112..455 CDD:214595 133/355 (37%)
G-alpha 133..451 CDD:206639 125/330 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455806
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10218
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
65.850

Return to query results.
Submit another query.