DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and gpa-9

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001256444.1 Gene:gpa-9 / 191659 WormBaseID:WBGene00001671 Length:96 Species:Caenorhabditis elegans


Alignment Length:96 Identity:45/96 - (46%)
Similarity:65/96 - (67%) Gaps:1/96 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 WFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRMKFENLNKRKDQKEIYTH 323
            :|..|:|||||||.||||.||..:.:|:.||:|.|....:.|..|||::|.:||..|::| ||.|
 Worm     2 YFHSTAIILFLNKIDLFEIKITHTNITVAFPDYEGPRERDCALEYIRVQFISLNNNKNRK-IYQH 65

  Fly   324 LTCATDTNNVKFVFDAVTDVIIKNNLKQIGL 354
            :|.||||..::.|.|.:.|:||..:||.:|:
 Worm    66 VTSATDTARIQVVIDMLFDIIISASLKMVGV 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 44/93 (47%)
G-alpha 35..349 CDD:206639 42/89 (47%)
gpa-9NP_001256444.1 P-loop_NTPase <2..91 CDD:304359 42/89 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54330
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.