DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and arf-1

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001367325.1 Gene:arf-1 / 175801 WormBaseID:WBGene00000182 Length:181 Species:Caenorhabditis elegans


Alignment Length:152 Identity:41/152 - (26%)
Similarity:63/152 - (41%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 TRVKTTGI-IETHFSCKQLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVALSGYDLVLAEDEEM 241
            |.:.|.|. :|| ...|.:.|.::|||||...|..|.|.|:....:||.|..:..:.|....||:
 Worm    44 TTIPTIGFNVET-VEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVGEAREEL 107

  Fly   242 NRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKIKRSPLTICFPEYTGTNTFEEAANYIRM 306
            .||:...:|.|::          :::|.||:||        |..:...|.|.           ::
 Worm   108 MRMLAEDELRDAV----------LLVFANKQDL--------PQAMNAAEVTD-----------KL 143

  Fly   307 KFENLNKRKDQKEIYTHLTCAT 328
            ...:|..|    ..|...||||
 Worm   144 GLHSLRNR----SWYIQATCAT 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 41/152 (27%)
G-alpha 35..349 CDD:206639 41/152 (27%)
arf-1NP_001367325.1 P-loop_NTPase 5..179 CDD:422963 41/152 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.