DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and LOC108179047

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021326059.1 Gene:LOC108179047 / 108179047 -ID:- Length:160 Species:Danio rerio


Alignment Length:159 Identity:46/159 - (28%)
Similarity:74/159 - (46%) Gaps:37/159 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 LVLAEDEEMNRMIESLKLFDSICNSKWFVETSIILFLNKKDLFEEKI--KRSPLTICFPEYT--- 292
            :|:.||...||:.|:|.||.||.|::|....|:||||||:|:..||:  .:|.:...||::.   
Zfish     1 MVIREDNNTNRLREALALFRSIWNNRWLRTISVILFLNKQDMLAEKVLAGKSKIEDYFPDFAYYT 65

  Fly   293 --------------GTNTFEEAAN----------------YIRMKFENLNKRK--DQKEIYTHLT 325
                          .....|:.:|                :||.:|..::...  .:...|.|.|
Zfish    66 LPDKVKKRKCVWKRKKRNGEDVSNITPDPGEDPRVTRAKFFIRDEFLKISTESGDGRHYCYPHFT 130

  Fly   326 CATDTNNVKFVFDAVTDVIIKNNLKQIGL 354
            ||.||.|::.||:...|:|.:.:|:|..|
Zfish   131 CAVDTENIRRVFNDCRDIIQRMHLRQYEL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 45/156 (29%)
G-alpha 35..349 CDD:206639 43/152 (28%)
LOC108179047XP_021326059.1 P-loop_NTPase <1..154 CDD:328724 43/152 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D754573at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.