DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and vwa1

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002938896.1 Gene:vwa1 / 100485693 XenbaseID:XB-GENE-956807 Length:496 Species:Xenopus tropicalis


Alignment Length:196 Identity:40/196 - (20%)
Similarity:76/196 - (38%) Gaps:33/196 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SKNIDRALRAEGER--------AASEVKLLLLGAGESGKSTIVKQMKIIHDTGYSQEECEEYRRV 73
            |:.|.||::...:|        |.|.:|..|.......::.:.|.|..:.| |.|.::..:..::
 Frog    96 SQEIQRAIQNIKQRMGDTNTGKALSYIKENLFDERSGSRAEVPKVMVWVTD-GLSTDDISQPMQL 159

  Fly    74 VFSNTVQSLMVIIRAMGR---LKIEFADPSRTDIARQFFTHASAADEGILLPEI------VLLMK 129
            :..   ..:.|.|.:.||   |::..|..:.:|....|   ....|..|:..|:      ::..:
 Frog   160 LKD---MGVTVFIVSTGRGNYLELSAAASTPSDTHLHF---VDVDDLHIITKELRDSIIELIRAR 218

  Fly   130 KLWADGGVQQSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTTGIIETHFSCKQ 194
            :|.|......||..:....|:...||||...:.::.|.         |...:|....:|.|:.:.
 Frog   219 RLHAQDITTTSFRLTWPRLLSKETGYYLLEYELVSDPE---------RKFSRTLSGDQTSFTLQN 274

  Fly   195 L 195
            |
 Frog   275 L 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 40/196 (20%)
G-alpha 35..349 CDD:206639 33/170 (19%)
vwa1XP_002938896.1 vWA_collagen 36..196 CDD:238749 22/106 (21%)
fn3 218..285 CDD:365830 15/67 (22%)
FN3 310..394 CDD:238020
fn3 398..475 CDD:365830
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0082
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.