DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and mcoln2

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002931739.3 Gene:mcoln2 / 100379826 XenbaseID:XB-GENE-5767908 Length:555 Species:Xenopus tropicalis


Alignment Length:276 Identity:57/276 - (20%)
Similarity:96/276 - (34%) Gaps:64/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ERAASEVKLLLL----GAGESGKSTIVKQMKIIHDTGYSQEECEEYRRVVFSNTVQSLMVIIRAM 89
            |.:....|.|.|    |..|...|..|...|.::|:.:.  ..|:|||         |..|  ::
 Frog    82 EESTMAFKHLFLKGYTGRDEDDCSRTVYTQKDVYDSIFF--AIEQYRR---------LKEI--SL 133

  Fly    90 GRLKIEFADPSRTDIARQ-------------FFTHASAADEGILLPEIVLLMKKLWADGGVQQSF 141
            |.:..|..:.....:.:|             |:...:...|.:.|...||..|:......:..:|
 Frog   134 GTVAYERGEKRGLKVCKQHYHQDSIHPSNDTFYIDPNVETECLHLQHEVLASKQPPNMSAINSTF 198

  Fly   142 ARSREYQL-NDSAGYYLNSLD----RIAQ-PNYIPTQQDVLRTRVKTTGIIETHF-------SCK 193
            .....|:| .....:.|..:|    |:.: |:.......::......:|.|:..|       .||
 Frog   199 FYLELYRLIKVEISFKLKGIDLQTMRVRELPDCYVFHNRIIFNNQAHSGKIKLFFESEASVQDCK 263

  Fly   194 QLHFKLFDVGGQRSERKKWIHCFEGVTAIIFCVA---LSGYDLVLA---EDEEMNRMIESLKLFD 252
            ..|     :.|...:...:|..|:|. .|:.|:|   |....:|||   :...:|...|..|  .
 Frog   264 DWH-----ISGCTQKNTHYILLFDGF-VILTCLASLILCTRSIVLAIKLQKRFVNFFFERYK--R 320

  Fly   253 SICNSK-------WFV 261
            .||:|.       |:|
 Frog   321 HICSSDKLEFINGWYV 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 57/276 (21%)
G-alpha 35..349 CDD:206639 56/270 (21%)
mcoln2XP_002931739.3 ELD_TRPML 98..265 CDD:425394 33/179 (18%)
PKD_channel <377..501 CDD:400395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000052
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X53
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.