DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Galphai and vps72

DIOPT Version :9

Sequence 1:NP_477502.1 Gene:Galphai / 38765 FlyBaseID:FBgn0001104 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002937316.2 Gene:vps72 / 100135721 XenbaseID:XB-GENE-989807 Length:362 Species:Xenopus tropicalis


Alignment Length:162 Identity:33/162 - (20%)
Similarity:64/162 - (39%) Gaps:40/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 YSQEECEEYRRVV---FSNTVQSLMVIIRAMGRLKIEFAD--PSRTDIARQFFTHASAADEGILL 121
            :.::|.::.||||   :...:|.|        :.|.:.||  ||....:|....|....      
 Frog    73 HEEDEPKKKRRVVTKAYKEPIQLL--------KPKPKKADAPPSSAAKSRPEKPHPQET------ 123

  Fly   122 PEIVLLMKKLWADGGVQ---QSFARSREYQLNDSAGYYLNSLDRIAQPNYIPTQQDVLRTRVKTT 183
            ||..:..:|.......:   |:|.|.:|.|:...         :...|:     ||...|:|:  
 Frog   124 PEDAVDSRKQMRQSTTEHTRQTFLRVKERQIQSK---------KKKGPH-----QDRPLTQVE-- 172

  Fly   184 GIIETHFSCKQLHFK-LFDVGGQRSERKKWIH 214
             ::|.....::::.: |.:.....::|||.:|
 Frog   173 -LLEEAKITEEINIRSLENYERLEADRKKQVH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GalphaiNP_477502.1 G_alpha 14..353 CDD:214595 33/162 (20%)
G-alpha 35..349 CDD:206639 33/162 (20%)
vps72XP_002937316.2 YL1 7..217 CDD:368602 33/162 (20%)
YL1_C 285..313 CDD:369784
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.