DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9953 and PRCP

DIOPT Version :9

Sequence 1:NP_648067.2 Gene:CG9953 / 38763 FlyBaseID:FBgn0035726 Length:508 Species:Drosophila melanogaster
Sequence 2:NP_955450.2 Gene:PRCP / 5547 HGNCID:9344 Length:517 Species:Homo sapiens


Alignment Length:561 Identity:137/561 - (24%)
Similarity:223/561 - (39%) Gaps:124/561 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LLLLGLLAPISGMGFRRGRLTKGFL---GEPSKIPTLQRSLHSEDLWFEQR-------------- 62
            ||||..|||.:.:..|......|.|   ..|:.:|.:.::.  ..|:|:|:              
Human     8 LLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNY--SVLYFQQKALAAGQLHICIIQL 70

  Fly    63 -------LDHFKSSDKRTWQQRYFVNADFYRNDSSAPVFLMIGGEGEASAKWMREGAWVHYAEHF 120
                   :|||..:..:|:.|||.| ||.|...:...:....|.||:........|.....||..
Human    71 NHYKTPLVDHFGFNTVKTFNQRYLV-ADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEEL 134

  Fly   121 GALCLQLEHRFYGKSHPTADLS---TENLHYLSSEQALEDLASFVTAMKVKFNLGDGQKWIAFGG 182
            .|:.:..|||:||:|.|..|.|   :.:|::|:|||||.|.|..:..:|......:.|..||.||
Human   135 KAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGG 199

  Fly   183 SYPGSLAAWAREKYPELIYGSISSSGPLLAEVDFKE---YFEVVKASLAAYKPECVDAVTRSFAQ 244
            ||.|.||||.|.|||.::.|::::|.|:....|...   :.::|........|.|.:::.||:..
Human   200 SYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDA 264

  Fly   245 VEILLKHMIGQRSLDEKFKTCTP--------IKDSI-ENDLDMANFFENLAGNFAGVVQYNKDNS 300
            :..|.....|.:.|......|:|        :||.| |..:::|......|.||.         .
Human   265 INRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVDYPYASNFL---------Q 320

  Fly   301 PHATITIDDICDVMLNTTAGPPVTRLGLVNDMLLKESNTTCLD--YKYDKMVADMKNVSWDSETA 363
            |.....|..:|..:.|..          |:|.||.::....|:  |.|...|..: |:|..:.::
Human   321 PLPAWPIKVVCQYLKNPN----------VSDSLLLQNIFQALNVYYNYSGQVKCL-NISETATSS 374

  Fly   364 KGMRQWTYQTC------------------HEFGFYQTSDNPADTFGDR---------FGVDFFIR 401
            .|...|:||.|                  |.:...:.||:....:|.|         :|      
Human   375 LGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYG------ 433

  Fly   402 QCMDVFSKNMNAKFLKLVVSATNDNYGALKPKTTNVLYVHGSIDPWHALGLVKSTNAALPTIYIE 466
                  .||:::.                    ||:::.:|.:|||...|:.|.....|..:.|.
Human   434 ------GKNISSH--------------------TNIVFSNGELDPWSGGGVTKDITDTLVAVTIS 472

  Fly   467 GTAHCANMYEPVKTDPPQLVAARNKILKFLAK-LLDGYTSA 506
            ..||..::......||..::.||:..::.:.. :.|.|.||
Human   473 EGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYDSA 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9953NP_648067.2 Peptidase_S28 61..492 CDD:253262 119/495 (24%)
PRCPNP_955450.2 Abhydrolase 78..498 CDD:304388 118/472 (25%)
MhpC 125..>235 CDD:223669 43/109 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D555765at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.