DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mis12 and Mis12

DIOPT Version :9

Sequence 1:NP_648066.1 Gene:Mis12 / 38762 FlyBaseID:FBgn0035725 Length:181 Species:Drosophila melanogaster
Sequence 2:NP_001381976.1 Gene:Mis12 / 501706 RGDID:1564837 Length:206 Species:Rattus norvegicus


Alignment Length:205 Identity:51/205 - (24%)
Similarity:92/205 - (44%) Gaps:30/205 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFNSLAYDQKFFNFTAAQ-----LSAEREHI------VQDIIKKGIGQIID-KIKTPATAELLE 53
            |..:.:||:.:||.||...     ..|.::|:      |:.:|.|.:..|.| :|.:..|.:..|
  Rat     1 MSVDPMAYEAQFFGFTPQTCLLRIYIAFQDHLFEVMQAVEQVILKKLEGIPDCEISSIQTRKCTE 65

  Fly    54 AEKETVERRFQASASKGLKALRELDSKVFHVPPHVLHPEHMFVENQYTSEEEEQKTAR-LEELKA 117
            .....::.||.....|..:.:.:   .:..:||::|.||....|....|||:.|...: ::||:.
  Rat    66 KFLCFMKGRFDNLFGKMEQLILQ---SILQIPPNILLPEDKCQETNPFSEEKFQLLKQEIKELQE 127

  Fly   118 KYRENM----AMLAHLKIEEEKYAAMEDLIQ--KEIEMQDRVQ------RSCSSL--NITKLKQF 168
            ||:..:    |:||.|:.::...|.:.:.:.  .|:|...|.|      .|..||  |..||:..
  Rat   128 KYKVELCTEQALLAELEEQKTVKAKLRETLTFFDELENIGRYQGTSNFRESLVSLVQNCRKLQDI 192

  Fly   169 WNQVPLQIKK 178
            .:.|..:.|:
  Rat   193 RDNVEKESKR 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mis12NP_648066.1 None
Mis12NP_001381976.1 Mis12 8..140 CDD:399099 37/148 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107894
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.