Sequence 1: | NP_648065.1 | Gene: | CG10064 / 38761 | FlyBaseID: | FBgn0035724 | Length: | 742 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_067514.2 | Gene: | Wsb2 / 59043 | MGIID: | 2144041 | Length: | 404 | Species: | Mus musculus |
Alignment Length: | 238 | Identity: | 54/238 - (22%) |
---|---|---|---|
Similarity: | 102/238 - (42%) | Gaps: | 17/238 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 429 NDGIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLI-VTGGIEGQVRVWKIDPYRQDLVGVL 492
Fly 493 KDHSGPITSLDINYLDTEVISACTDGSCVIWDIKRMTR-KQVVTANTQFMSASYFPTGVQVITCG 556
Fly 557 SDGRIIYWMVYNGALIRELTASK-----------KSSVNCLAINETGDYFITVGSDLQVKLWDYN 610
Fly 611 SGAVVGIGSEHASSVISCAYSPCMTMFVTGSTDGSLIIWDVPR 653 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10064 | NP_648065.1 | WD40 | <25..188 | CDD:295369 | |
WD40 | 33..434 | CDD:225201 | 3/4 (75%) | ||
WD40 repeat | 65..106 | CDD:293791 | |||
WD40 repeat | 111..151 | CDD:293791 | |||
WD40 repeat | 159..186 | CDD:293791 | |||
WD40 | 280..652 | CDD:225201 | 52/235 (22%) | ||
WD40 | 366..650 | CDD:238121 | 51/233 (22%) | ||
WD40 repeat | 370..407 | CDD:293791 | |||
WD40 repeat | 412..449 | CDD:293791 | 7/19 (37%) | ||
WD40 repeat | 456..494 | CDD:293791 | 10/38 (26%) | ||
WD40 repeat | 499..535 | CDD:293791 | 6/36 (17%) | ||
WD40 repeat | 541..576 | CDD:293791 | 9/34 (26%) | ||
WD40 repeat | 583..617 | CDD:293791 | 8/33 (24%) | ||
WD40 repeat | 625..651 | CDD:293791 | 7/25 (28%) | ||
Wsb2 | NP_067514.2 | WD40 repeat | 29..89 | CDD:293791 | |
WD40 | <30..182 | CDD:330360 | 15/51 (29%) | ||
WD 1 | 105..148 | 7/16 (44%) | |||
WD40 | 121..360 | CDD:238121 | 51/232 (22%) | ||
WD 2 | 151..191 | 9/40 (23%) | |||
WD40 repeat | 157..195 | CDD:293791 | 10/38 (26%) | ||
WD 3 | 195..234 | 7/38 (18%) | |||
WD40 repeat | 200..236 | CDD:293791 | 6/35 (17%) | ||
WD 4 | 237..276 | 8/38 (21%) | |||
WD40 repeat | 244..289 | CDD:293791 | 10/44 (23%) | ||
WD 5 | 291..330 | 10/38 (26%) | |||
WD40 repeat | 296..328 | CDD:293791 | 7/31 (23%) | ||
WD40 repeat | 336..372 | CDD:293791 | 9/29 (31%) | ||
SOCS_WSB_SWIP | 364..402 | CDD:239702 | 1/1 (100%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |