DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10064 and wds

DIOPT Version :9

Sequence 1:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001245503.1 Gene:wds / 53428 FlyBaseID:FBgn0040066 Length:361 Species:Drosophila melanogaster


Alignment Length:306 Identity:66/306 - (21%)
Similarity:125/306 - (40%) Gaps:52/306 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   352 LNIK-TWVLKLLRTCHTKSVYCITFPKNYSGVFATSGKECIRIWSSGRKQELLRIMVYNFNCACV 415
            |::| .:.||.....|||:|..:.|..|...:.::|..:.|:||.:                   
  Fly    56 LSVKPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGA------------------- 101

  Fly   416 RFTHDGTSIVSVWNDGIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLIVTGGIEGQVRVWK 480
               :||....::                     :.|..|.|.:|.:|..||:|:|..:..::||:
  Fly   102 ---YDGKFEKTI---------------------SGHKLGISDVAWSSDSRLLVSGSDDKTLKVWE 142

  Fly   481 IDPYRQDLVGVLKDHSGPITSLDINYLDTEVISACTDGSCVIWDIKRMTRKQVVTANTQFMSASY 545
            :...:.  :..||.||..:...:.|.....::|...|.|..|||::.....:.:.|::..:||.:
  Fly   143 LSTGKS--LKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVH 205

  Fly   546 F-PTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQVKLWDY 609
            | ..|..:::...||....|...:|..::.|.......|:.:..:..|.|.:....|..:|||||
  Fly   206 FNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDY 270

  Fly   610 NSGAVVGIGSEHASSVISCAYSPCMT----MFVTGSTDGSLIIWDV 651
            :.|..:...:.|.:... |.::....    ..|:||.|..:.||::
  Fly   271 SKGKCLKTYTGHKNEKY-CIFANFSVTGGKWIVSGSEDNMVYIWNL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 16/82 (20%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 66/306 (22%)
WD40 366..650 CDD:238121 61/288 (21%)
WD40 repeat 370..407 CDD:293791 7/36 (19%)
WD40 repeat 412..449 CDD:293791 2/36 (6%)
WD40 repeat 456..494 CDD:293791 10/37 (27%)
WD40 repeat 499..535 CDD:293791 7/35 (20%)
WD40 repeat 541..576 CDD:293791 8/35 (23%)
WD40 repeat 583..617 CDD:293791 10/33 (30%)
WD40 repeat 625..651 CDD:293791 7/29 (24%)
wdsNP_001245503.1 WD40 64..358 CDD:238121 64/298 (21%)
WD40 repeat 75..112 CDD:293791 9/79 (11%)
WD40 repeat 118..154 CDD:293791 10/37 (27%)
WD40 repeat 159..195 CDD:293791 7/35 (20%)
WD40 repeat 202..237 CDD:293791 8/34 (24%)
WD40 repeat 244..280 CDD:293791 10/35 (29%)
WD40 repeat 288..325 CDD:293791 7/28 (25%)
WD40 repeat 331..357 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.