| Sequence 1: | NP_648065.1 | Gene: | CG10064 / 38761 | FlyBaseID: | FBgn0035724 | Length: | 742 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001263303.1 | Gene: | WDR38 / 401551 | HGNCID: | 23745 | Length: | 315 | Species: | Homo sapiens |
| Alignment Length: | 210 | Identity: | 55/210 - (26%) |
|---|---|---|---|
| Similarity: | 95/210 - (45%) | Gaps: | 22/210 - (10%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 451 HNKGCSALAVASSGRLIVTGGIEGQVRVWKIDPYRQDLVGVLKDHSGPITSLDINYLDTEVISAC 515
Fly 516 TDGSCVIWDIKRMTRKQVVTANTQFM-SASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASK 579
Fly 580 KS--------SVNCLAINETGDYFITVGSDLQVKLWDYN--SGAVVGIGSEHASSVISCAYSPCM 634
Fly 635 TMFVTGSTDGSLIIW 649 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG10064 | NP_648065.1 | WD40 | <25..188 | CDD:295369 | |
| WD40 | 33..434 | CDD:225201 | |||
| WD40 repeat | 65..106 | CDD:293791 | |||
| WD40 repeat | 111..151 | CDD:293791 | |||
| WD40 repeat | 159..186 | CDD:293791 | |||
| WD40 | 280..652 | CDD:225201 | 55/210 (26%) | ||
| WD40 | 366..650 | CDD:238121 | 55/210 (26%) | ||
| WD40 repeat | 370..407 | CDD:293791 | |||
| WD40 repeat | 412..449 | CDD:293791 | |||
| WD40 repeat | 456..494 | CDD:293791 | 9/37 (24%) | ||
| WD40 repeat | 499..535 | CDD:293791 | 7/35 (20%) | ||
| WD40 repeat | 541..576 | CDD:293791 | 10/35 (29%) | ||
| WD40 repeat | 583..617 | CDD:293791 | 13/35 (37%) | ||
| WD40 repeat | 625..651 | CDD:293791 | 8/25 (32%) | ||
| WDR38 | NP_001263303.1 | WD40 | <11..299 | CDD:225201 | 55/210 (26%) |
| WD 1 | 19..58 | 9/39 (23%) | |||
| WD40 | 20..301 | CDD:238121 | 55/210 (26%) | ||
| WD40 repeat | 26..61 | CDD:293791 | 9/36 (25%) | ||
| WD 2 | 61..100 | 9/38 (24%) | |||
| WD40 repeat | 67..103 | CDD:293791 | 7/35 (20%) | ||
| WD 3 | 103..142 | 9/38 (24%) | |||
| WD40 repeat | 108..144 | CDD:293791 | 10/35 (29%) | ||
| WD 4 | 145..184 | 13/47 (28%) | |||
| WD40 repeat | 151..189 | CDD:293791 | 13/46 (28%) | ||
| WD 5 | 190..228 | 9/29 (31%) | |||
| WD40 repeat | 195..230 | CDD:293791 | 8/24 (33%) | ||
| WD 6 | 231..272 | ||||
| WD40 repeat | 236..272 | CDD:293791 | |||
| WD 7 | 275..313 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 295..315 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG0266 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||