DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10064 and CG10931

DIOPT Version :9

Sequence 1:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_611261.1 Gene:CG10931 / 37024 FlyBaseID:FBgn0034274 Length:345 Species:Drosophila melanogaster


Alignment Length:246 Identity:57/246 - (23%)
Similarity:107/246 - (43%) Gaps:13/246 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 CV---RFTHDGTSIVSVWNDGIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLIVTGGIEGQ 475
            ||   :|:.:|.::||...|.:::.:.....|.|.::. .|..|.:.:|.:::| ||.:...:..
  Fly    58 CVTGLKFSSNGENLVSSSGDRLLKLWDLSATRCIQSLA-GHGDGVNDVAWSAAG-LIASCSDDMT 120

  Fly   476 VRVWKIDPYRQDLVGVLKDHSGPITSLDINYLDTEVISACTDGSCVIWDIKRMTRKQVVTANTQ- 539
            ||:|  |...:..|.||:.||....|...|.....:.|...|.:..:||::.....::|.|:.. 
  Fly   121 VRLW--DARSKLCVKVLEGHSRYSFSCCFNPQANLLASTSFDETVRLWDVRTGKTLKIVHAHQDP 183

  Fly   540 FMSASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQV 604
            ..|..:...|...:|...||.:..|....|.:::.|.......|..:..:..|.|.::...:..:
  Fly   184 ITSVDFHRDGNIFVTSSYDGLVRLWDSSTGHVLKTLVDVDNIPVGYVKFSPNGRYILSSTLNNTL 248

  Fly   605 KLWDYNSGAVVGIGSEHASSVISCAYSPCMT----MFVTGSTDGSLIIWDV 651
            :||:|.....:.....|.:. ..|:.|...|    ..|:||.|.:|.||::
  Fly   249 RLWNYKKPKCMRTYRGHLNE-FYCSNSNFSTTGGIWIVSGSEDNTLCIWNL 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 7/22 (32%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 57/246 (23%)
WD40 366..650 CDD:238121 56/243 (23%)
WD40 repeat 370..407 CDD:293791
WD40 repeat 412..449 CDD:293791 9/37 (24%)
WD40 repeat 456..494 CDD:293791 11/37 (30%)
WD40 repeat 499..535 CDD:293791 6/35 (17%)
WD40 repeat 541..576 CDD:293791 7/34 (21%)
WD40 repeat 583..617 CDD:293791 6/33 (18%)
WD40 repeat 625..651 CDD:293791 10/29 (34%)
CG10931NP_611261.1 WD40 <48..341 CDD:225201 57/246 (23%)
WD40 49..341 CDD:238121 57/246 (23%)
WD40 repeat 59..96 CDD:293791 8/37 (22%)
WD40 repeat 102..137 CDD:293791 11/37 (30%)
WD40 repeat 142..178 CDD:293791 6/35 (17%)
WD40 repeat 185..220 CDD:293791 7/34 (21%)
WD40 repeat 227..263 CDD:293791 6/35 (17%)
WD40 repeat 271..309 CDD:293791 10/28 (36%)
WD40 repeat 314..340 CDD:293791
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.