DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10064 and WDR88

DIOPT Version :9

Sequence 1:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_775750.3 Gene:WDR88 / 126248 HGNCID:26999 Length:472 Species:Homo sapiens


Alignment Length:412 Identity:80/412 - (19%)
Similarity:155/412 - (37%) Gaps:119/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 TCHTKSVYCITFPKNYSGVFATSGKEC-IRIWS--SGRKQELLRIMVYNF---------NCACVR 416
            |||    :|:...|..||.:     :| :::|.  .|.       :|.:|         .|:   
Human   107 TCH----FCVDDTKLLSGSY-----DCTVKLWDPVDGS-------VVRDFEHRPKAPVVECS--- 152

  Fly   417 FTHDGTSIVSVWNDGIIRAFTPITGRLIYAIPNAHNKGCSALAVASSGRLIVTG-GIEGQVRVWK 480
            .|.|.:.:::...|..:||:...||:|::.:  .::....:...:..|:.:|:| .::..:.:  
Human   153 ITGDSSRVIAASYDKTVRAWDLETGKLLWKV--RYDTFIVSCKFSPDGKYVVSGFDVDHGICI-- 213

  Fly   481 IDPYRQDLVGVLKDHSGPITSLDINYLDTEVISACTDGSCVIWDIKRMTRKQVVTANTQFMSASY 545
            :|......|.|:|||            .|..|::|    |                        :
Human   214 MDAENITTVSVIKDH------------HTRSITSC----C------------------------F 238

  Fly   546 FPTGVQVITCGSDGRIIYWMVYNGALIRELTASKKSSVNCLAINETGDYFITVGSDLQVKLWDY- 609
            .|...:|.:...|..|..|.|.:.|.:..:|.:..::::......:|.:..|...|..:|:|:. 
Human   239 DPDSQRVASVSLDRCIKIWDVTSQATLLTITKAHSNAISNCCFTFSGHFLCTSSWDKNLKIWNVH 303

  Fly   610 -----NSGAVVGIGSEHASSVISCAYSPCMTMFVTGSTDGSLIIWDVPRDF----------WGRP 659
                 |.||.|.:...|..||.||.::...:..::|..|.::.||||...:          |   
Human   304 TGEFRNCGACVTLMQGHEGSVSSCHFARDSSFLISGGFDRTVAIWDVAEGYRKLSLKGHNDW--- 365

  Fly   660 NPPDVT-----KYSLPKTSSKT-------RMSDVP--SRVNSGTNLKTTKGENID---GLLKATP 707
             ..||.     |:.|..:..:|       .:.::|  .:......||..:.|..|   .:.|:..
Human   366 -VMDVAISNNKKWILSASKDRTMRLWNIEEIDEIPLVIKYKKAVGLKLKQCERCDRPFSIFKSDT 429

  Fly   708 KDDLC--CVECPPCAKKDTKGV 727
            ..::.  ||.|    :.||:|:
Human   430 SSEMFTQCVFC----RIDTRGL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 16/81 (20%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 61/306 (20%)
WD40 366..650 CDD:238121 57/302 (19%)
WD40 repeat 370..407 CDD:293791 7/39 (18%)
WD40 repeat 412..449 CDD:293791 9/36 (25%)
WD40 repeat 456..494 CDD:293791 6/38 (16%)
WD40 repeat 499..535 CDD:293791 4/35 (11%)
WD40 repeat 541..576 CDD:293791 7/34 (21%)
WD40 repeat 583..617 CDD:293791 9/39 (23%)
WD40 repeat 625..651 CDD:293791 7/25 (28%)
WDR88NP_775750.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..22
WD40 96..391 CDD:238121 68/350 (19%)
WD40 97..>398 CDD:225201 68/357 (19%)
WD 1 100..139 11/47 (23%)
WD40 repeat 106..142 CDD:293791 12/50 (24%)
WD 2 143..182 9/41 (22%)
WD40 repeat 148..181 CDD:293791 9/35 (26%)
WD 3 184..224 5/41 (12%)
WD40 repeat 190..226 CDD:293791 6/37 (16%)
WD 4 228..267 12/78 (15%)
WD40 repeat 233..270 CDD:293791 10/64 (16%)
WD 5 271..310 5/38 (13%)
WD40 repeat 276..317 CDD:293791 9/40 (23%)
WD 6 319..358 11/38 (29%)
WD40 repeat 324..348 CDD:293791 5/23 (22%)
WD 7 361..400 6/42 (14%)
WD40 repeat 366..390 CDD:293791 5/23 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 447..472 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.