DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10064 and wsb2

DIOPT Version :9

Sequence 1:NP_648065.1 Gene:CG10064 / 38761 FlyBaseID:FBgn0035724 Length:742 Species:Drosophila melanogaster
Sequence 2:NP_001230313.1 Gene:wsb2 / 100307075 ZFINID:ZDB-GENE-081104-26 Length:406 Species:Danio rerio


Alignment Length:383 Identity:78/383 - (20%)
Similarity:131/383 - (34%) Gaps:114/383 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 EIYGLNIKTWVLKLLRTCHTKSVY----CITFPKNYS---GVFATS-GKECIRI--W-------- 394
            :.|.:.....:|..|:..|...:|    |.|:...:|   ..||.| |...|::  |        
Zfish     6 QAYNVKEPPELLAELKAAHRPRLYGTPDCETWSARFSPDGSYFAWSMGFGVIKLLPWPLTTRDSA 70

  Fly   395 -SSGRKQELLRIMVYNFNCACVRFTHDGTSIVSVWNDGIIRAFTPITGRLIYAIPNAHNKGCSAL 458
             |...|:::|       ||   ||.        ||    ..||.|.|..   .:.:||..     
Zfish    71 ESCCSKEKIL-------NC---RFL--------VW----ALAFGPCTST---RVDSAHQH----- 105

  Fly   459 AVASSGRLIVTGGI-EGQVRVWKIDPYRQDLVGVLKDHSGPITSLDINYL---DTEVISACTDGS 519
              .....|::..|: .|.::||.:.  ..:|...|..|..|:.  |:.:.   ...:|||..|.:
Zfish   106 --RREHELLLAAGLHNGSIQVWLVS--TGNLQFTLTGHQAPVR--DLVFAPNGSLTLISASRDKT 164

  Fly   520 CVIWDI-KRMTRKQVVTANTQ--FMSASYFPTGVQVITCGSDGRIIYWMVYNGALIRELTAS-KK 580
            ..|||: |:.....|:.....  |..|....:.|....|..|.::..|.:.:...::.||.. ::
Zfish   165 LRIWDLGKKGASPHVLRGPNYWVFRCAVSPDSSVIASVCNLDSKVYLWSLRSYTFMKHLTYDHER 229

  Fly   581 SSVNC--------LAI----NETG---DYFITVGSDL---------------------------- 602
            :..:|        |||    :.||   |.:....:||                            
Zfish   230 TMASCDFSQDGALLAIASYHSNTGWWLDLWDPYTADLLTRVQDCEVCAYRSDNLLTSLSFSPVAL 294

  Fly   603 --------QVKLWDYNSGAVVGIGSEHASSVISCAYSPCMTMFVTGSTDGSLIIWDVP 652
                    .:::||.....:|.....:.:..:.||:.|...:..||..||.:..|.||
Zfish   295 LLAFKDYRALQIWDVERDKLVADTDHNRAGGVCCAFHPQGGVIATGCRDGHVKFWKVP 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10064NP_648065.1 WD40 <25..188 CDD:295369
WD40 33..434 CDD:225201 23/104 (22%)
WD40 repeat 65..106 CDD:293791
WD40 repeat 111..151 CDD:293791
WD40 repeat 159..186 CDD:293791
WD40 280..652 CDD:225201 76/381 (20%)
WD40 366..650 CDD:238121 72/361 (20%)
WD40 repeat 370..407 CDD:293791 13/55 (24%)
WD40 repeat 412..449 CDD:293791 9/36 (25%)
WD40 repeat 456..494 CDD:293791 7/38 (18%)
WD40 repeat 499..535 CDD:293791 10/39 (26%)
WD40 repeat 541..576 CDD:293791 5/34 (15%)
WD40 repeat 583..617 CDD:293791 12/84 (14%)
WD40 repeat 625..651 CDD:293791 8/25 (32%)
wsb2NP_001230313.1 WD40 <37..352 CDD:225201 69/350 (20%)
WD40 37..350 CDD:295369 68/348 (20%)
WD40 repeat 41..74 CDD:293791 8/32 (25%)
WD40 repeat 80..138 CDD:293791 20/91 (22%)
WD40 repeat 143..181 CDD:293791 10/39 (26%)
WD40 repeat 188..224 CDD:293791 6/35 (17%)
WD40 repeat 231..279 CDD:293791 9/47 (19%)
WD40 repeat 284..309 CDD:293791 1/24 (4%)
WD40 repeat 325..349 CDD:293791 7/23 (30%)
SOCS 355..391 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0266
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.