DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and PLC4

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001318832.1 Gene:PLC4 / 835984 AraportID:AT5G58700 Length:597 Species:Arabidopsis thaliana


Alignment Length:121 Identity:32/121 - (26%)
Similarity:43/121 - (35%) Gaps:31/121 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 HYDILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSE 213
            |:|..|.|:|..            ||.|.|....|   .:||....|:.|.|        .|:.|
plant   488 HFDSYSPPDFFV------------RVGIAGAPVDE---VMEKTKIEYDTWTP--------IWNKE 529

  Fly   214 LS-KLAANAFLAQRIS----SINSLSAVCEATGADVSEV---ARAVGLDSRIGSKF 261
            .: .||.......|:.    .:|........|...|||:   .|||.|.:|.|.|:
plant   530 FTFPLAVPELALLRVEVHEHDVNEKDDFGGQTCLPVSEIRQGIRAVPLFNRKGVKY 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 32/121 (26%)
PLC4NP_001318832.1 PLN02230 1..597 CDD:177875 32/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.