DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and PLC1

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_195565.2 Gene:PLC1 / 830010 AraportID:AT4G38530 Length:564 Species:Arabidopsis thaliana


Alignment Length:410 Identity:70/410 - (17%)
Similarity:134/410 - (32%) Gaps:100/410 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RAADLKYVESAARMIAE--------IAQSN---KIVVEKSTVPVRAAESIMHILRANQKPGIHYD 151
            |.|.|.||:.....:..        :...|   :.:...:..|:..:..:.|.::|   |..||.
plant    55 RHAGLDYVQDIFHSVKHHNVFHHHGLVHLNAFYRYLFSDTNSPLPMSGQVHHDMKA---PLSHYF 116

  Fly   152 ILSNPEFLAEGTAINDLLNADRVLIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSK 216
            :.:.......|..:|...:.:.::          ||:.|          ...::..:.|.:. |.
plant   117 VYTGHNSYLTGNQVNSRSSVEPIV----------QALRK----------GVKVIELDLWPNP-SG 160

  Fly   217 LAANAFLAQRISSINSLSAVCEA---TGADVSEVARAVGLDSRIGSKFLQASVG------FGGSC 272
            .||.....:.::|...|.....|   ....||:....:.|:..:..| |||.|.      :.|..
plant   161 NAAEVRHGRTLTSHEDLQKCLTAIKDNAFHVSDYPVIITLEDHLPPK-LQAQVAKMLTKTYRGML 224

  Fly   273 FQKDILNLIYICENL-NLPEVAAYWQQVIDMNEYQKRRFSQKIIESLFNTVSDKRIAILGFAFKK 336
            |::       :.|:. :.|.......:::...:..|.....|.:.:                  .
plant   225 FRR-------VSESFKHFPSPEELKGKILISTKPPKEYLESKTVHT------------------T 264

  Fly   337 NTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQII-------DDLTHPSVTESPEKVKKAVQI 394
            .|...:||:...|...:|||  ..|:....|....:|       .|.:...:::.||   |.:::
plant   265 RTPTVKETSWNRVANKILEE--YKDMESEAVGYRDLIAIHAANCKDPSKDCLSDDPE---KPIRV 324

  Fly   395 HSDPY---SAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDGRKILDH----ERLQQIGF 452
            ..|..   :.||...     |:...|...:..|||....:    .|......|    ...|.:.|
plant   325 SMDEQWLDTMVRTRG-----TDLVRFTQRNLVRIYPKGTR----VDSSNYDPHVGWTHGAQMVAF 380

  Fly   453 HVQTIGKK-YQRTGLLRSWG 471
            ::|..||: :...|:.|..|
plant   381 NMQGHGKQLWIMQGMFRGNG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 65/395 (16%)
PLC1NP_195565.2 PLN02228 1..564 CDD:177873 70/410 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.