Sequence 1: | NP_476980.1 | Gene: | sgl / 38760 | FlyBaseID: | FBgn0261445 | Length: | 476 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_191153.1 | Gene: | AT3G55940 / 824760 | AraportID: | AT3G55940 | Length: | 584 | Species: | Arabidopsis thaliana |
Alignment Length: | 208 | Identity: | 42/208 - (20%) |
---|---|---|---|
Similarity: | 70/208 - (33%) | Gaps: | 64/208 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 110 RMIAEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRV 174
Fly 175 LIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAA-------------------- 219
Fly 220 --------NAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVG------FG- 269
Fly 270 -------GSCFQK 275 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
sgl | NP_476980.1 | PLN02353 | 1..459 | CDD:177986 | 42/208 (20%) |
AT3G55940 | NP_191153.1 | PLN02222 | 1..584 | CDD:177868 | 42/208 (20%) |
EF-hand_like | 26..102 | CDD:286375 | 13/74 (18%) | ||
PI-PLCc_GDPD_SF | 102..426 | CDD:301322 | 29/133 (22%) | ||
C2_PLC_like | 454..583 | CDD:175974 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |