DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and AT3G55940

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_191153.1 Gene:AT3G55940 / 824760 AraportID:AT3G55940 Length:584 Species:Arabidopsis thaliana


Alignment Length:208 Identity:42/208 - (20%)
Similarity:70/208 - (33%) Gaps:64/208 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RMIAEIAQSNKIVVEKSTVPVRAAESIMHILRANQKPGIHYDILSNPEFLAEGTAINDLLNADRV 174
            |.:.::.:.:|...|::...|.|:.|::|      :.|:|.|......|....:.::.|      
plant    47 RFLIDVQKQDKATKEEAQDIVNASSSLLH------RNGLHLDAFFKYLFAVTNSPLSSL------ 99

  Fly   175 LIGGEETPEGHQAVEKLSWIYEHWIPKQNILTTNTWSSELSKLAA-------------------- 219
                    |.||.::.....|..:....:.||.|..||:.|:|..                    
plant   100 --------EVHQDMDAPLSHYFIYTGHNSYLTGNQLSSDCSELPIIEALKKGVRVIELDIWPNSD 156

  Fly   220 --------NAFLAQRISSINSLSAVCEATGADVSEVARAVGLDSRIGSKFLQASVG------FG- 269
                    ...|...:..|..|.|:.| ...|||:....|.|:..:..| |||.|.      || 
plant   157 EDGIDVLHGRTLTSPVELIKCLRAIRE-HAFDVSDYPVVVTLEDHLTPK-LQAKVAEMVTDIFGE 219

  Fly   270 -------GSCFQK 275
                   |.|.::
plant   220 MLFTPPSGECLKE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 42/208 (20%)
AT3G55940NP_191153.1 PLN02222 1..584 CDD:177868 42/208 (20%)
EF-hand_like 26..102 CDD:286375 13/74 (18%)
PI-PLCc_GDPD_SF 102..426 CDD:301322 29/133 (22%)
C2_PLC_like 454..583 CDD:175974
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.