DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sgl and AT3G01010

DIOPT Version :9

Sequence 1:NP_476980.1 Gene:sgl / 38760 FlyBaseID:FBgn0261445 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_186750.1 Gene:AT3G01010 / 821321 AraportID:AT3G01010 Length:158 Species:Arabidopsis thaliana


Alignment Length:151 Identity:74/151 - (49%)
Similarity:102/151 - (67%) Gaps:13/151 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 LFNTVSDKRIAILGFAFKKNTGDTRETAAITVCQTLLEEGAALDIYDPKVEPEQIIDDLT----- 377
            :|||||:|:|.:|.|||||   |||||.||.||:.||.:.|.:.||||:|..|||..|||     
plant     1 MFNTVSNKKIVVLEFAFKK---DTRETPAIDVCKGLLGDKARISIYDPQVTEEQIQRDLTMNTFD 62

  Fly   378 --HPSVTE--SPEKVKKAVQIHSDPYSAVRATHALVICTEWDEFVDLDFKRIYQSMMKPAYIFDG 438
              ||...:  ||..||: |.:..|.|:|.:..|.:.:.|||||:..||::||:::|.|||::|||
plant    63 WDHPLHLQPMSPTTVKQ-VSVAWDAYAATKDAHGICLLTEWDEYKTLDYERIFENMQKPAFVFDG 126

  Fly   439 RKILDHERLQQIGFHVQTIGK 459
            |.:.|.|:|::|||.|.:|||
plant   127 RNVFDAEKLRKIGFIVYSIGK 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sglNP_476980.1 PLN02353 1..459 CDD:177986 72/149 (48%)
AT3G01010NP_186750.1 PLN02353 <1..152 CDD:177986 74/151 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 123 1.000 Domainoid score I1826
eggNOG 1 0.900 - - E1_COG1004
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D915490at2759
OrthoFinder 1 1.000 - - FOG0002453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.